KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2481Help
Entry
XNC1_2481         CDS       T01274                                 

Gene name
adhE
Definition
(GenBank) multifunctional: acetaldehyde-CoA dehydrogenase (N-terminal); iron-dependent alcohol dehydrogenase (C-terminal); pyruvate-formate lyase deactivase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00071  Fatty acid degradation
xne00350  Tyrosine metabolism
xne00620  Pyruvate metabolism
xne00625  Chloroalkane and chloroalkene degradation
xne00626  Naphthalene degradation
xne00650  Butanoate metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_2481 (adhE)
   00620 Pyruvate metabolism
    XNC1_2481 (adhE)
   00650 Butanoate metabolism
    XNC1_2481 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    XNC1_2481 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    XNC1_2481 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XNC1_2481 (adhE)
   00626 Naphthalene degradation
    XNC1_2481 (adhE)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XNC1_2481 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     XNC1_2481 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CBJ90540
UniProt: D3VH95
Position
2434143..2436482
Genome map
AA seq 779 aa AA seqDB search
MVVTQVAELNELVARVKKAQHEFAHFSQEQIDRIFRAAALAAADARIPLAKLAVSESGMG
IVEDKVIKNHFASEYIYNAYKDDKTCGILSEDNTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKKATNKAAEIVLKAAVEAGAPENIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDESADIKRAIASILMSKTF
DNGVICASEQSVIVVEAVYEQVRERFSTHGGYLLKGKELKAVQDIILKNGNLNAAIVGQP
ATKIAEMAGISVPDNTKILIGEVTLVDETEPFAHEKLSPLLAMYRGKNFEDAVEKAEKLV
EMGGIGHTSCLYTEQDNQAGRIKYFGNKMKTARILINTPASQGGIGDLYNFKLSPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVAADGAK
RAFIVTDRFLFNHGYTDQVINVLKSYGMETDVFFEVEADPTLSIVRKGTEQMHLFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDITGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKDFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFMIVLRHDAAMQKLQTI
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcactcaggttgccgaactcaatgaattagttgctcgtgtaaaaaaagcccag
catgaatttgctcatttttctcaggaacaaattgaccgtattttccgtgccgcagcgctt
gccgctgccgatgctcgtattccattggcaaaattagccgtatctgaatcgggtatggga
attgtggaagataaagtgatcaaaaaccacttcgcttctgagtatatatataacgcctat
aaagatgataagacctgcggtattttgtctgaagataacactttcggtactatcactatc
gcagaacctattggcctgatttgcgggatcgttcctacaaccaatccaacatccactgcg
attttcaaagcactcatcagcctgaaaacccggaatggtattattttctcgcctcatcca
cgcgccaaaaaggcaaccaataaagcagcagaaatcgttttaaaagccgcagtcgaagcc
ggggcaccagaaaatattatcggttggattgatgaaccttctgttgaactttcaaatgct
ctgatgcaccaccctgatattaacctgattctggccacaggcggtccgggcatggtcaaa
gcggcctatagctcaggtaaacctgcaattggtgtgggtgccggcaatacgcctgtcgtg
atcgatgaatcagccgatatcaaacgtgctatagcctctattctgatgtccaaaacgttt
gataatggggtgatttgtgcttcagaacaatctgttattgttgttgaggcggtttatgaa
caagttcgtgagcgcttttcaacccacggcggatatctccttaaaggaaaagaactcaaa
gccgtccaggatattatcttaaaaaatggtaacttaaacgcagccattgttggtcagcca
gcaacaaaaatcgctgaaatggccggtatcagtgttcccgataatacgaagatcctcatc
ggtgaagtcacgcttgtggatgaaaccgaaccttttgcccatgagaagttatcgccgttg
cttgccatgtatcgcggtaaaaattttgaagatgcagttgaaaaagcagaaaaactggtc
gaaatgggcggtattgggcacacatcgtgtctttatactgaacaagataaccaagccggg
cgcattaaatatttcggcaataaaatgaaaacggcccggattttgatcaacacacccgct
tcccagggtgggatcggggatttatacaactttaagctatccccttctctcacactggga
tgtggttcttggggaggtaactctatctccgaaaacgtggggccaaagcatttgatcaac
acgaaaactgttgccaaaagagccgaaaatatgttgtggcataaacttccgaaatcaatc
tatttccgacgcggttcccttcccatcgcattagaagaagtggctgcggatggggcaaaa
cgcgctttcattgtgacagatcgcttcttatttaatcatggctataccgatcaggtgatc
aatgttttgaaatcatacggtatggaaaccgacgttttctttgaagttgaagcagacccg
actttaagtatcgtccgcaaagggactgaacaaatgcatttgtttaagccagatgtcatt
attgcccttggcggtggctccccgatggatgcagccaaaattatgtgggtgatgtatgaa
catccggaaacacatttcgaagaattagctctgcgttttatggatattcgcaaacgcatc
tataagtttccgaaaatgggcgtgaaagccaaaatgatcgccattacaacaacatcaggc
acaggttcagaagtcacaccttttgccgttgttaccgatgacatcaccgggcagaaatat
cctctggcagattatgctctgacgcctgatatggcgattgtcgatgccaacttggttatg
gatatgcctaaatcactgtgcgcctttggtggccttgatgcggttactcacgcactggaa
gcctatgtttctgtgttggcaaatgaatattcagatggacaagctttacaagccctgaaa
ctgttgaaagattttctacctgccagttaccatgaaggtgcaaaaaacccagttgcccgt
gagcgtgtccataatgcagcaaccattgcaggcattgcctttgccaatgctttcttgggg
gtgtgtcattccatggcccacaaacttggctctgagtttcatattccacatggtttagca
aatgcgctattgatctgtaacgtcattcgctataacgctaatgacaatccgacaaaacaa
accgcatttatgatcgtcctcaggcacgacgccgctatgcagaaattgcagactatttag

DBGET integrated database retrieval system