KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2524Help
Entry
XNC1_2524         CDS       T01274                                 

Definition
(GenBank) Conserved hypothetical protein (probable component of SST VI)
  KO
K11902  type VI secretion system protein ImpA
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_2524
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N sCache_like
Motif
Other DBs
NCBI-ProteinID: CBJ90582
UniProt: D3VHD7
Position
2477036..2478082
Genome map
AA seq 348 aa AA seqDB search
MNIDELLTPISAEYACGENLEYDDEFLALEQAIIEKPEKQFGDVIIPAEPPHWGEVEKHA
IHLFSRTKDLNVIIALMQAWINLRGLSGYADGLYLLRQTLERYWTEVWPRLEFDGSYDLL
RRLNTLAAIEDNSPCTIKAQNSLLLKSASSELTLQEAYSLLSGSVTNISSYTGGRPRLIN
ELKQKSASPEMLIIMTIRDHLTALIEIICHHLSNSHMPELPQFLKQLDTIIKFCTTPDSE
TAKEKNPELLDSASSDTQGASMEQQTSEESVLFHWQSVEVNHRDEAHILLEKAKAYFLKH
EPSHPAPLMISRIQQLIDRDFMTIIQDLAPEGLNQLEIIFGHPHHSDI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgatgagttactgacgccaatcagtgccgaatatgcctgcggagaaaatctg
gaatacgatgacgaatttctggcattagaacaggcgataatcgaaaaaccagaaaaacag
tttggtgatgtcatcatcccggccgaacctccccattggggagaggtggaaaaacacgct
attcacctgttctcccgtaccaaagatttgaatgtcatcatagcgctgatgcaggcatgg
ataaatttacgcggattatcgggttatgctgatggtttgtacttactccgccaaacgctg
gaacgttattggacagaggtgtggcccagactggagtttgatggttcgtatgacctttta
cggcgtttaaacacgttggccgcgattgaagacaactcaccctgtacgataaaagcccag
aattctcttttactaaaaagtgcttcaagcgaactgacattacaggaagcgtattcactg
ctgagtggctcagtcaccaatattagcagttataccggcgggcgccccagattaatcaac
gagttgaaacaaaaatcagccagtcctgaaatgctgatcatcatgactatccgtgatcat
cttactgccctgattgagataatttgccatcatttatccaacagccatatgcccgaactg
ccacagtttctgaaacaactggatacaattattaaattttgtaccactcctgactcagaa
accgcgaaggaaaaaaacccggaattacttgattcagcatcgtcggatacacaaggcgct
tcaatggagcaacaaacctcagaagaaagcgtacttttccattggcaatccgttgaggtc
aatcatcgtgatgaagcacacatcttattagaaaaagccaaagcctattttcttaaacac
gaacccagccacccggcgccactcatgattagtcgcattcaacagctcattgatcgtgat
ttcatgacgattattcaagatcttgcaccagaaggattaaaccagctagaaatcattttt
ggtcacccacatcattctgatatttga

DBGET integrated database retrieval system