KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2530
Entry
XNC1_2530         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein (probable component of SST VI cluster)
  KO
K11896  type VI secretion system protein ImpG
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_2530
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_2530
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CBJ90588
UniProt: D3VHE3
Position
2483187..2485061
AA seq 624 aa
MDSKLLEYYNRELVYLREMGKEFAERYPKVANRLGMHGIDVADPYVERLMEGFAFLTSRI
QLKMDAEFPRFSGHLLEMLYPNYLSPTPSMAIVELQPDTRKGDISHGFSVPRGTLMHCQT
LKRDGITLQYATTQDVILQPLHLENVELGKIPANLPLAGLNLNHYGAVSALRIRFSCKEK
FFLNELDFNKLIFFLSGPDIQSQQLLELIMEHSVGIVCQILGDDPQYQVLPDISPHHEGF
DDNQSLFPDDPRNFSGYRQLQEYFAFPARFQFFSLSGMGSLLKQTTKKSEFELILLLNKV
DTDLESLVDTSYLTLNCTPVINLFPKVTERITVQESNNEYHLVVDNSRPLDYEIFSVQRL
HGANIKRKETQIFRPFWSTFSDDKNNYGAYFSLRRDPRVLSEHARHYGTRSSYIGTEMFV
SIVDEQHSPWPDQLKFLTADVMCTNRDLPTMLRQQDLDNFAMLDSIPIHQIAFLKRPTIP
HPALAQGSATWKLINQLQLNYLNFMDKGDEQGTQALRQLLSLYANLADPAITRQINGIRH
CSLKTVYRRVPEPGPIVFARGVSIRLEVNEQEFAGVSPWLLGSVLGKLFSHLVTMNSFTE
MTLYSQQRGDIGFWPASMGNKKLI
NT seq 1875 nt   +upstreamnt  +downstreamnt
ttggacagcaagttacttgaatattacaaccgcgaattagtgtatctgcgtgaaatgggt
aaagaatttgccgaacgttaccctaaagttgccaatcgtctgggtatgcacggtattgat
gttgccgatccctatgttgaacgcctgatggaaggattcgcttttctgacatcccgcatt
caattgaaaatggatgcggaattcccgcgtttttccgggcacttactggaaatgttgtat
cctaactatctgtctccgaccccttcaatggccattgtcgaactccagccagatacccgc
aaaggcgatatcagccacggattttcagtaccacgcggaacacttatgcactgccagacc
ttaaaaagagatggcattactttgcaatatgcgacaacacaagatgtcatcctgcaacct
ttgcatctggaaaatgttgaactgggcaagatccccgcgaacctgccgctggccggctta
aaccttaaccactatggtgcggtcagtgcactgcggatacgttttagttgtaaagaaaaa
tttttcctcaatgagctggatttcaacaaactcatctttttcctttcaggtccggacatt
caatcccaacagttgctggaactgattatggagcactctgttggcatcgtatgccaaatt
ctgggtgatgatccccaatatcaggttttgcccgatatttcaccccatcatgaaggattt
gatgataatcaatccttattccctgacgatccacgtaattttagtggttatcggcaactt
caggaatattttgcatttccggcacgtttccagtttttcagtctcagcggaatgggatca
ttactgaaacagaccacaaaaaagagtgagtttgagctgattttgctgttaaacaaagtc
gataccgatttggaaagtttggtggatacctcttacctgacgttaaattgtacacctgtg
attaatttatttcccaaagtgactgaacgtatcaccgtacaagaaagcaacaatgaatat
catttagttgttgataattcacgtcctctggattacgaaattttttcggtgcaacgtctg
cacggggcgaatatcaagcgcaaagaaacacaaatattccgacccttctggtctactttc
agcgacgataaaaacaattacggtgcctatttttctttgcgccgtgatccccgcgtctta
tctgaacatgcccgtcattacggaacccgatcgagctatatcggtacagaaatgtttgtc
tctattgttgatgagcaacactctccgtggcctgatcaactgaaattcctgactgcggat
gttatgtgtaccaaccgtgatttacccacaatgctgcgccaacaagatctcgataatttt
gccatgctggattctatccccattcatcaaattgcctttctcaaacgaccgacaatcccg
catccggccttggcccagggttctgccacctggaaattaatcaatcaactacaactcaat
tacttgaattttatggataaaggagatgaacaaggaacgcaggcattacgacaattactg
agtctatatgcaaatctggcagatcccgctatcacccgccagattaatggcattcgccat
tgctcattaaagacggtttaccgacgggttccggaacccgggccaatcgtatttgcccgt
ggtgtcagtatccggcttgaagtgaatgaacaggaattcgccggggtcagcccttggtta
ctgggcagtgtattgggtaaacttttctcgcatttggtcaccatgaactcatttactgaa
atgacattgtatagccagcaacgtggtgatatcggcttttggcctgccagtatgggtaac
aaaaaattaatataa

DBGET integrated database retrieval system