KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2661Help
Entry
XNC1_2661         CDS       T01274                                 

Gene name
purC
Definition
(GenBank) phosphoribosylaminoimidazole-succinocarboxamide synthetase (SAICAR synthetase)
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00230  Purine metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
Module
xne_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XNC1_2661 (purC)
Enzymes [BR:xne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     XNC1_2661 (purC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-ProteinID: CBJ90715
UniProt: D3VI75
Position
complement(2619225..2619938)
Genome map
AA seq 237 aa AA seqDB search
MQKKAELYRGKAKTVYTTDNPDLLVLEFRNDTSALDGERIEQFDRKGMVNNKFNHFIMSK
LEEAGIPTQMEQLLSDNESLVKKLDMVPVECVIRNRAAGSLVKRLGVEEGMVLNPPLFDL
FLKDDAKHDPMVNESYCETFGWVSKAHLSEMKRLSYKANDVLSKLFDDAGLILVDFKLEF
GLFKGQVILGDEFSPDGSRLWDKQTMDKMDKDRFRQSLGGLIEAYEEVARRIGVILD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaaagctgaattgtatcgtggaaaggcaaaaacagtgtataccactgataat
cctgacctgcttgtgctggaattccgtaatgatacatcagcattggatggtgaacgcata
gaacagtttgatcgcaaggggatggtgaataataaattcaaccatttcatcatgagtaaa
ctggaagaagcgggcatcccgacgcaaatggaacagctattgtcagataatgaatctttg
gtgaaaaaactcgatatggtgcccgtagagtgtgttattcgtaaccgtgctgcgggttcc
ctcgtgaagcgattgggcgttgaagagggcatggtgcttaatccacccttgtttgatctc
ttcctgaaagatgatgctaaacatgatccaatggtcaatgaatcttattgtgaaaccttc
ggttgggttagcaaagcgcatctgtctgagatgaaacgcctcagctacaaagccaatgac
gtattgagtaaattgtttgatgatgcgggtttgattttggtggatttcaaattggaattt
ggcctgttcaaaggtcaggtcatattgggagatgaattttcaccggatggtagccgctta
tgggataagcagaccatggacaaaatggacaaagatcgtttccgccagagtctgggtggt
ttgattgaagcgtatgaagaagttgcacgccgtattggtgttattttggattaa

DBGET integrated database retrieval system