KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2703Help
Entry
XNC1_2703         CDS       T01274                                 

Gene name
icd
Definition
(GenBank) e14 prophage; isocitrate dehydrogenase, specific for NADP+
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00020  Citrate cycle (TCA cycle)
xne00480  Glutathione metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
xne01210  2-Oxocarboxylic acid metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xne_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XNC1_2703 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XNC1_2703 (icd)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     XNC1_2703 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Nsp3_PL2pro tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CBJ90757
UniProt: D3VIB7
Position
complement(2663398..2664651)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITIDAKGKLNVPNNPVIPYIEGDGIGVDVTPVMLKVVDAAVQKAYSG
ERKISWMEIYTGEKSTHVYGKDVWLPDETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
QDEMGVNKIRFPQQCGIGVKPCSEEGTKRLVRAAIEYAIDNDRESVTLVHKGNIMKFTEG
AFKDWGYELARTEFGGELLDGGPWVKIKNPKSGKDIIIKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSVILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMDNANLLKCSEFGDAIISNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaaaattactattgatgccaaaggt
aaattaaatgttccgaataaccctgtaatcccttatatcgaaggggatggcattggtgtt
gatgttacgccggtcatgctgaaagtggttgatgctgcggttcagaaagcttatagcggt
gagcgcaaaatttcttggatggaaatctatacaggtgaaaaatccacccatgtgtatggc
aaagatgtctggttgccagatgaaacactggatctgattcgtgaatatcgtgttgctatc
aaaggccctctgacaacgcctgtgggcggtggtattcgctcattgaacgttgcattgcgt
cagcaattggatctgtatgtgtgtctgcgcccagtccgttactatcaaggtactccaagc
cctgttaaacagcctgaattgactgatatggtcattttccgcgagaacgcagaagatatt
tatgcgggtattgagtggaaagcgggttcagcagaagcggacaaagtgattaaattcctg
caggatgaaatgggtgtcaataagatccgtttccctcaacagtgtggtatcggcgtgaaa
ccttgttcagaagaaggaaccaaacgtttggtgcgcgccgcgattgaatacgctattgat
aatgatcgtgaatcagtgacgctggttcacaaaggcaatatcatgaaattcacggaaggc
gcttttaaagactggggttatgaactggctcgcactgaattcggcggagaacttctggat
ggcggtccatgggttaagatcaaaaatcctaagagcggtaaggacatcatcattaaagat
gtgatcgcggatgcctttttgcagcaaattctgttgcgtccggctgaatatgatgtgatc
gcgtgtatgaacctgaatggcgactatatttctgacgcattggcagcccaggttggtggt
attggaattgctccaggtgcaaatattggtgatgagtgtgctctgtttgaagcaacacat
ggtactgcacctaagtatgctggtcaggataaagtgaatccgggttctgttattctttcc
gcagaaatgatgttgcgccacatggggtggttcgaagccgctgatttaatcgttaaggga
atggaaggcgcgatcgctgccaagactgtgacttacgatttcgaacgcctgatggataac
gctaatctgctgaaatgtagtgagttcggtgacgcaattatttctaacatgtaa

DBGET integrated database retrieval system