KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2946Help
Entry
XNC1_2946         CDS       T01274                                 

Gene name
relE
Definition
(GenBank) Qin prophage; part of two-component toxin-antitoxin system with RelB, transcriptional corepressor of relBE operon
  KO
K06218  mRNA interferase RelE/StbE
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xne02048]
    XNC1_2946 (relE)
Prokaryotic defense system [BR:xne02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    XNC1_2946 (relE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin ParE-like_toxin
Motif
Other DBs
NCBI-ProteinID: CBJ91000
UniProt: D3VJU1
Position
complement(2939582..2939866)
Genome map
AA seq 94 aa AA seqDB search
MTYSLKFEKRALKEWEKLGHPIREQFKKKLSERLENPHISSARLSGRNNLYKIKLCSSGY
RLVYEVNDHAIVLLVIAVGKRSGNQVYSVADERE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgacttatagtctcaaatttgaaaagcgggcactaaaagagtgggaaaaactagggcat
cctatccgtgagcagttcaaaaagaaattgtctgagcgtttagaaaacccccatatatct
tcagctcgattgagtggccgcaataatctctacaaaatcaaattatgttcttctggctat
cgtttagtctacgaagtcaatgatcatgctattgttttactggtgatcgctgttggtaaa
agatctggaaatcaggtttattcagtcgctgatgaacgtgaataa

DBGET integrated database retrieval system