KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3042Help
Entry
XNC1_3042         CDS       T01274                                 

Gene name
lysA
Definition
(GenBank) diaminopimelate decarboxylase, PLP-binding
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00300  Lysine biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01230  Biosynthesis of amino acids
Module
xne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    XNC1_3042 (lysA)
Enzymes [BR:xne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     XNC1_3042 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-ProteinID: CBJ91096
UniProt: D3VK37
Position
complement(3017387..3018682)
Genome map
AA seq 431 aa AA seqDB search
MTTSIFSGDSGKYFTPDNLLRLPAQYGTPLWLYDGDNIIKQIKKLKQFDVIRFAQKACSN
THILRLMREQGVKVDSVSLGEVERALYAGFQPGRDKSEIVFTADVIDEATLSRVIELDIP
VNVGSIDMLDQIGTRQSGHPVWLRLNPGFGHGHSQKTNTGGENSKHGIWYQDLPLAIEKI
HQYGLKLAGLHMHIGSGVDYQHLASVCNAMVEQVILCGEDIQAISAGGGLSIPYNTGEEA
VDTEHYYSLWHEARQRIEQHLGHAVELEIEPGRFLVAESGILMAEVRAVKSMGSRNYVLV
DAGFSDLMRPAMYGSYHHISVLPVEQSENGTSMQEAGSQETLLQETLVAGPLCESGDVFT
QLEGGEVVPRMLPSVRVGDYLIFHDTGAYGASMSSNYNSRPLIPEVLFIEGEVHLIRRRQ
TIEELLLLESC
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcaattttctccggcgattcaggcaagtatttcactcctgataatttactc
cgtttacctgctcagtacggaacaccattatggctttatgatggcgataacatcatcaaa
caaatcaaaaaattaaaacagtttgatgttatccggttcgcacagaaagcgtgttcaaat
acccatatcctgcgtttgatgagagagcagggcgtgaaggtggattcagtatcgttgggg
gaagttgaacgggcgctttatgctggttttcaacccggccgtgataaatcagaaattgtg
tttactgcggatgtgattgatgaagccacactgagccgcgttattgagttggatattcct
gtaaacgttggctccattgatatgttggatcagattggaacacgtcaatcgggccatccg
gtctggttacgcctcaatcccggatttggtcacggacatagccaaaaaaccaatacgggc
ggcgaaaatagcaagcacgggatttggtatcaggaccttccgttggcgattgagaagatt
caccagtatggattgaaattagcagggctgcatatgcatatcggttcgggtgtggattat
cagcatcttgccagcgtatgtaacgcaatggtggagcaggtcatattgtgtggcgaggat
attcaggccatttcagcaggcggtgggttatcaatcccctataacacaggtgaagaagcg
gtagatactgaacactattacagtttatggcatgaagcgcgtcagcggattgaacagcat
ttaggacacgctgttgaattagagattgaaccgggccgttttctggtggctgaatccggt
atcttgatggcggaagtacgagcggtaaaatcgatgggcagtcgcaattatgtgttggta
gacgcgggattcagtgatttgatgcgtcctgcgatgtatggcagctatcaccatatttca
gttttacctgtagagcagagtgaaaatggcacgagtatgcaggaagccggatcgcaggaa
acattattgcaggaaacgttggtagccgggccattatgtgaatctggtgatgtttttacc
caattggaaggcggggaggttgtaccgcgaatgctgccttcggttcgtgtcggagattat
ttgattttccatgatacgggagcttacggggcgtcaatgtcttcaaattataatagtcgc
cctttgatcccggaagttttgtttatcgaaggggaagttcatttgattcgacgtcgccaa
acaatagaagaactgctattgttggaatcctgttga

DBGET integrated database retrieval system