KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3205Help
Entry
XNC1_3205         CDS       T01274                                 

Gene name
gltX
Definition
(GenBank) glutamate tRNA synthetase, catalytic subunit
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne00970  Aminoacyl-tRNA biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
xne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_3205 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XNC1_3205 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_3205 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_3205 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xne02048]
    XNC1_3205 (gltX)
Enzymes [BR:xne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     XNC1_3205 (gltX)
Amino acid related enzymes [BR:xne01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   XNC1_3205 (gltX)
Transfer RNA biogenesis [BR:xne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XNC1_3205 (gltX)
 Prokaryotic type
   Other AARSs
    XNC1_3205 (gltX)
Prokaryotic defense system [BR:xne02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    XNC1_3205 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c Imm-NTF2
Motif
Other DBs
NCBI-ProteinID: CBJ91257
UniProt: D3VLD1
Position
3149119..3150534
Genome map
AA seq 471 aa AA seqDB search
MSKIKTRFAPSPTGYLHVGGARTALYSWLYSRHNKGEFVLRIEDTDLERSTQEAIDAIMD
GMNWLNLNWDEGPYYQTKRFDRYNQVIDEMLKQDTAYRCYCSKERLEQLRETQMANGEKP
RYDGQCLDSECQHSHDEPHVVRFRNPQEGSVIFNDSIRGPIEFSNQELDDLIIRRTDGSP
TYNFCVVIDDWDMEITHVIRGEDHINNTPRQINILKALGAPVPEYVHVSMILGDDGKKLS
KRHGAISVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFSVEEMTELFSLDAISKSASAFN
TEKLQWLNHHYINTLPAEEVAVHLAWHIEQQAIDTRTGPELVDLIKLLGERCKTLKEMAA
SCRYFYEEFAEFDADAAKKHLRPVARQPLEVARAKLAAITEWTPENIHHAIQVTTDELEV
GMGKVGMPLRVAVTGAGQSPSVDVTIHAINQARSLARIDKALAYIAQREAQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaaacccgttttgcaccaagtcctactggctatcttcatgttggtggt
gcacgtaccgcactgtattcctggttatatagtcgccacaataaaggtgaattcgttctt
cgtattgaagacactgatctggaacgctccactcaagaagccattgacgcaattatggac
gggatgaactggttaaatctgaattgggatgaaggtccttattaccagaccaaacgtttc
gaccgttataaccaagttattgatgagatgctgaagcaagatacagcttatcgctgttat
tgttccaaggagcgtttggagcaactgcgtgaaacacaaatggcaaatggtgaaaaacca
cgttatgacgggcaatgccttgatagcgaatgccaacacagccatgatgaaccccatgtt
gtacgtttccgcaatccgcaggaaggttcagtcatttttaatgatagcatccgtggcccc
attgaattcagcaatcaggaactggatgatttgattattcgtcgtaccgacggctcaccc
acttataacttctgtgttgtcattgatgactgggatatggaaatcactcatgttattcgt
ggtgaagaccatatcaacaatactccgcgccaaatcaacattcttaaagccctcggtgcc
ccagttccagaatatgtccacgtttctatgatcctcggtgacgatggtaaaaaactctcc
aaacgccacggcgctatcagtgtaatgcagtaccgtgatgatggttatctgcctgaagcg
ctgttgaactatctggttcgcctgggttggtcacatggtgatcaggaaattttcagcgtt
gaagagatgactgaattattcagccttgatgccatcagcaaatccgccagtgcattcaat
actgaaaaactacaatggttgaaccatcattacattaataccctgccagcagaagaagtt
gctgtacatttggcgtggcatattgaacaacaagctatcgatacacgtacaggccctgag
ttggttgatttgatcaaactgttgggtgaacgctgcaagacgctaaaagagatggcagca
tcttgccgttacttctatgaagaatttgctgagttcgatgcggatgctgcgaaaaaacac
ttacgccctgttgctcgtcagccattagaagttgcccgtgcaaaattggccgctatcact
gaatggacacctgaaaatatccatcacgcaattcaagtaaccactgacgaactggaagtg
ggtatgggtaaagtgggcatgccactgcgtgttgctgtgacaggtgcaggacaatcacca
agtgttgatgtcacaattcatgccattaaccaagctcgttccttggcgcgtattgataag
gcattggcttatattgctcagcgtgaagcgcaataa

DBGET integrated database retrieval system