KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3548
Entry
XNC1_3548         CDS       T01274                                 
Name
(GenBank) putative plasmid transfer protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C DUF87 T4SS-DNA_transf CobU AAA_16 AAA_22
Other DBs
NCBI-ProteinID: CBJ91583
UniProt: D3VA19
Position
3422946..3425120
AA seq 724 aa
MSRRYVVEALLRPAVELNTALVSAVAAFVCIRAPWAIALAPSVSYVIAGGFAALAMIRTW
QGIQVIRYRRNLRRLPRYQMSTRQIPVSHRQLFLGRGFRWQQKHTQRLLDTRRPEVERFV
QPSHIYQFARALERRTEYRWPTLSALLRKDSPFNPVRPLPPVGGNPAIHGIEPQEADVFM
DLRERVGHTLVMGTTRVGKTRLAELLITQDIRRGEVVIVFDPKGDADLLRRIWAEAHRVG
RGNELSLFHLGWPEISARYNAVGRFGRVSEVASRLAGQLSGEGNSAAFREFAWRFVNIVA
RALVALGHRPDYQLITRYVNNISELYQLYASKVMEERMPVLLAQISHCLGTLKEKDIPRN
MQGQPDALRLWATEITLSSDAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKIAELLSPDYLNMRDLRPIFDWEQVIRKNGIVYIGLDALSDSDVASAVGNSMFADLVSV
AGQIYKYGMNAGLPVRHDGKLAINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSS
DIEARIGSPAKTAQVVGNFNTLMMLRVRDNRTAELLTSQLPEVEIYSKTLVSGHSDIADV
EQGQDFTSSTQDRVGTVKTPLVTPAEMINLPKGQAFALLEGGQLWKIRMPLPTGDDDDAL
MPASLQNRCAGTTAPVKTGGKKRGSFRSWHSQKTSPAHLPNRPASMACFIVCYGNGRGNS
LGLW
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagccgccgttatgtggttgaagccctgctgcgcccggccgttgagctgaatacagcg
ctggtctccgccgtggcggcgtttgtctgtatccgggcaccctgggccatcgcactggca
ccttccgtcagctatgtcatagcaggcggttttgctgcactggcgatgatacgcacatgg
caggggattcaggtcatccgttatcgcagaaacctgcgccgcctgccacgttaccagatg
agcaccaggcaaattcctgtcagtcaccggcagttgtttctgggcaggggctttcgctgg
caacagaagcatacccagcgtttgctggatacgcgacgaccggaagtggaacgatttgtg
caaccctcccatatctatcagtttgcccgcgcactggagcgccgaactgaataccgttgg
ccgacattatctgccctgctgcgtaaagactcaccatttaatccggtacgtccgttgcca
ccggtggggggcaatcctgctatccacggtattgagccacaggaagccgatgtttttatg
gatctgcgcgagcgggtcgggcacacgttggtgatggggacaacccgtgtaggaaaaact
aggctggccgaattgctgataacgcaggatatccgacgtggcgaggtggtgattgtgttt
gatcccaaaggggatgctgacctgttaaggcgtatctgggcagaagcgcaccgggtcggt
cgaggcaatgaactgtccctctttcatctgggctggccggagatttcagcccgctataac
gccgtcgggcggtttggccgggtttctgaagtggcgtcccgtctggccggtcagctcagc
ggcgaaggcaacagcgccgcgttccgtgaatttgcctggcggtttgtcaatattgtcgcc
cgggctttggtggctctggggcaccggccggattaccagcttatcacccgctacgtcaat
aatatcagcgaactgtatcagttatatgccagcaaagtgatggaagaaagaatgccggta
ttgttagcgcaaatcagtcattgcctcggtacactgaaagaaaaagacattccacgcaat
atgcaggggcagcccgatgctctgcggctctgggcaacggaaatcaccctgagctctgac
gcaggcaagcaactctatgacccgattctggatggtctgcgttctgccgtgcgttatgac
cgcacctattttgataaaattgtcgcgtccttgctgccgctgctggaaaaactgaccaca
ggcaaaattgcggaattattgtcaccggattatctcaatatgcgtgacctgcggcccatc
tttgactgggagcaggtgatccgcaaaaacggcattgtttatatcgggctggatgcgctg
tctgacagcgatgtggcctcggcggtgggcaacagtatgtttgcggatttggtgagtgtc
gccggacagatttataaatatggcatgaatgccggcttgccggttcgtcatgatggtaag
ctggcgattaatctgcattgtgatgaattcaacgaattgatgggtgatgagtttatcccg
ctgatcaataaaggcggcggggcagggatgcaggtgacggcgtatacccagacctcctcc
gatatcgaagcccgtattggcagcccggccaaaaccgcgcaggtggtgggcaacttcaat
accctgatgatgctgcgggtgcgggataaccggacggctgaactgctcaccagccagctg
ccggaagtggaaatctacagtaagaccctggtatcggggcattcagatattgccgatgtg
gaacaggggcaggattttacttcttccacacaggacagggtaggcaccgtcaaaacgccg
cttgtcacgcccgctgaaatgattaacctgccgaaagggcaggcgttcgcgctgctggaa
ggcgggcaactgtggaaaattcgcatgcctttgcccacgggggatgacgatgatgccctg
atgccggccagtttgcagaacagatgcgccggcactaccgcaccagtgaaaactggtggg
aagaaaaggggtagtttccggtcatggcacagtcagaaaaccagtcccgcccatcttccc
aaccgccccgcaagcatggcctgctttatcgtctgttatgggaatggccgtggcaactca
ttgggtttatggtga

DBGET integrated database retrieval system