KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3559
Entry
XNC1_3559         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein(fragment)
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: CBJ91593
UniProt: D3VA29
Position
3430526..3431392
AA seq 288 aa
MQIPGNGKATAQFPASFLSEQPAAGQNQPQSPSLQNPSKEENEQPVYTLPENATLVGSQA
MTALLGRVPVNGTVTDPYPFKILIGKDNLTANGIELPEVEGAVVSGSASGDWTLSCVRGQ
VNSITVVFQDGTVRTLPGSGQNTNTSANGIGWLSDENGIPCISGERKSNAATYLPTLFAL
SAMHSAGDALSESQRTAQTSGTGGITTALTGNAGQAALGKAMAGGMNDLSEWLRQRYSQT
FDAVYVPPGARVVVHITQRLAIDYETKGRKVRYGVSETAERDNQEALD
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcaaatccccggcaatgggaaagccacggcgcagttcccggcctcttttttaagtgaa
cagcccgccgccgggcaaaatcagccccaaagcccttcgcttcaaaacccgtcaaaggaa
gaaaatgaacagccggtctataccctgcctgaaaatgccacgttagtcggtagtcaggcc
atgacggcgttattaggtcgggtgccagttaatggcacagtcaccgacccctatccgttc
aaaatccttatcggcaaagataacctgacggccaacggcattgaactgccggaggtggaa
ggggcggtggtgtccggttcggccagtggtgactggacactctcctgcgtgcgcggtcag
gtcaattccatcacggttgtttttcaggatggcacggtgcgtaccctgccgggcagcggg
caaaacaccaataccagcgcgaacggcatcggctggctgtcggatgaaaacggcattccc
tgtatcagcggtgagcgcaaatccaacgccgccacctatctgccgaccctgtttgcgctc
tcggccatgcattcggccggcgatgccctgagtgaaagtcagcgtactgcccagaccagt
ggcacaggcggtatcaccaccgcgctaacgggcaatgccggacaggcggcattaggcaaa
gcgatggccggcggcatgaatgacctgagcgaatggctcagacagcgctacagccagacg
tttgatgcggtttacgtcccgcccggtgcccgtgttgtggtgcatatcacacaacgcctg
gcgattgattatgaaacgaaaggacgtaaggtgcgctacggcgtgagtgagaccgccgaa
cgtgataatcaggaagcattagattaa

DBGET integrated database retrieval system