KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3562
Entry
XNC1_3562         CDS       T01274                                 
Name
(GenBank) conserved hypothetical protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10 FtsK_SpoIIIE HerA_C AAA_22 AAA_29
Other DBs
NCBI-ProteinID: CBJ91596
UniProt: D3VA32
Position
3432137..3434908
AA seq 923 aa
MEKLKALNRPGKLREADEAAIYQANPSIIDYLPWVEYLEKEQCLLLDDGISVGAVYQIEP
IATEGRPAERLTEIRDQLEDAIQDSLEEDDISPWVVQFFCQDEDDPADYLNTLRGYVKPW
AQGTPFTDAFLAESEHHLNSIARPDGIFQDSLITGQPWRGQQRQTRMVVYRWLPDGRRSP
VNHLTLSAVAALNQVCERLVSSLASAGVIARRQHGGQIHRWLLRHFNPVPDWGMAKADFY
RTVGYETPTPFDLPVNNDFAESLWFTPPVSDPDAGVWWFDGLPHKAVPVERLRRPPEPGT
LTGEVKRGDNINALMDMMPAGTVVSLTIVAQAQDRLEEDFTRLSKNAVGENTESLRVRQD
VQEVKELLGRRHKLYRSALTFLVRGKDVADLNHRVHQLSATLLTAGLQPVRPEFSVSPLN
AWLRALPMCFNPQKDKKHGYSRLTWVQHLAGLLPVTGRSTGTGHPGFSFFNRGGAPLTFD
PMNKQDRTQNAHLLLFGPTGAGKSATLCASLIQLMAIHRPRLFIVEAGNSFGLLADYYES
LGLTVNKIGIRPGCGVSLALFADAHQLLQLSPEQLRINEADIPDTDEQQEEEGDEQRDIL
GEMEIAARLMITGGEKREEERLTRSDRGLIREAIMQAAQTSFDESRQMVASDLQNALYAI
ARNHQQDEHGQPLITAHRRARADEMASAMSMFTQGFEGELFNRPGTPWPEVDVTLIDLGT
LARENYSAQMALAMVSLINKVNNLAERDQYQDRELQLVIDEGHITTTNPLLSPYMTKVVK
MWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQIARFKKLTEEQKAVL
LSAGKLPRCYTEGVVLAKKIEALFRVVPPSLYLALGMTEKEEKAERRALMRAHQCSELEA
AVLVARKMDVVRGLKIDFVDNLL
NT seq 2772 nt   +upstreamnt  +downstreamnt
atggaaaaactcaaggcactgaaccgccccggcaaactgcgtgaagcggatgaagccgcc
atttatcaggccaatccttctattattgattacctgccctgggtggaatatctggaaaaa
gaacaatgcctgctgctggatgacgggatttccgtcggcgcggtttatcaaattgaaccc
atcgccaccgaaggccgtcctgctgagcggttgactgaaatccgggatcaactggaagat
gcgatccaggacagtctggaagaggacgatatttcgccatgggtggtgcagtttttttgt
caggatgaagatgatcctgctgactatctcaacaccttgcggggctatgtgaaaccctgg
gcacagggaacgccgtttactgacgcctttctggcggaatcagagcatcacctgaacagc
attgcacggcctgacgggatatttcaggacagcttaatcaccgggcaaccgtggcggggc
cagcagcgccagacccgcatggtggtttaccggtggctgcctgacgggcgcagatcccct
gtcaaccatctgaccttatcggcggtggctgcgctcaatcaggtctgcgagcggctggtt
tcatcactggcttctgccggtgtgattgcccgccggcaacatggcgggcagatccaccgc
tggttgctgcgtcattttaatccggtgccggactgggggatggcaaaagccgatttttac
cgtaccgtgggttacgaaacccccacaccgttcgatctcccggtcaataatgattttgcc
gaaagcctgtggttcaccccgccggtgtctgatcccgacgcgggcgtctggtggtttgac
gggttgccacataaagcggtgccggttgagcgtctgcgccgtccgccggaaccgggaaca
ctgacaggcgaagtgaaacggggcgacaatatcaatgccctgatggacatgatgccggca
gggacggtagtttcgctgaccattgtggcgcaggcacaggaccggctggaagaggatttt
acccgattgtcgaaaaatgccgtgggagaaaacactgaatcgctgcgcgtccggcaggat
gtgcaggaggtgaaggaacttctgggacggcggcataaactgtaccgcagtgcgctgacc
tttctggtgcggggcaaggatgtggctgacctgaatcaccgggtgcatcagttatccgcc
accctgctgacagcgggattacagcctgtccggccggaattcagtgtctcaccgctgaat
gcctggttacgggcactgccgatgtgctttaacccgcagaaagacaaaaaacacgggtac
agccgcctgacctgggtacagcatctggccgggttattgccggtgacaggccgttcgacc
ggcaccgggcatccggggttcagtttctttaaccggggcggtgcaccgctgacctttgat
ccgatgaacaaacaggatcgcacccagaatgcccacctgctgttatttggcccgacaggg
gcagggaaatccgccacattgtgcgcctcgctcattcagttgatggcgatacaccggccg
cgcctgtttattgtcgaagccggcaacagctttggtttactggccgattactatgagagt
ctggggctgacagtcaataaaattggtatcagaccgggttgtggcgtcagtctggcgctg
tttgccgatgcgcatcagctgttgcaactgagtcctgagcaattgcggattaacgaagct
gatattcctgataccgatgaacaacaggaagaggagggggatgaacagcgcgatattctg
ggcgaaatggaaattgccgcccgactgatgatcaccggtggtgaaaaaagagaggaagag
cgtctgacccgctctgatcgggggttaattcgtgaggccattatgcaggcggcacagacc
agctttgacgagtcccgccagatggtggcttcagacttacaaaatgcgctttatgccatc
gcccgtaatcaccagcaggatgagcacggtcagccgttaattactgcccaccggcgggca
cgggcggatgaaatggccagcgccatgtcgatgtttacccaggggttcgagggtgaactg
tttaaccgtcccggtacgccgtggccggaagtggatgtcaccctgattgatttgggcaca
ctggcacgggagaactactcggcgcaaatggcgctggcgatggtctcgctgattaacaaa
gtcaataatctggctgaacgggatcaatatcaggatcgcgaactgcaactggtgattgat
gaagggcatatcaccaccaccaacccgctgttatcaccgtatatgaccaaggtggtcaaa
atgtggcgtaaactcggcgcctggctgtggctcgccacccaaaacctggcggactatcct
gataccgctgaaaaaatgctgaatatggctgaatggtggctgtgcctgaccatgccaccg
gatgaagtagaacagattgcccggtttaagaagctgacggaagagcaaaaagcggtgctg
ctttctgccggtaaactgccccgctgttataccgaaggcgtcgtgctggcgaaaaaaatt
gaagccttatttcgggtggtcccaccgagcctctatctggcgctggggatgacggaaaaa
gaagaaaaggccgagcgacgggcattaatgcgggcacaccagtgcagtgaactggaggcg
gcggtattggtggccaggaaaatggatgttgttcggggattgaagattgattttgtagat
aacttgctataa

DBGET integrated database retrieval system