KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3572
Entry
XNC1_3572         CDS       T01274                                 
Name
(GenBank) conserved hypothetical protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: DUF1525 TraI_2_C CcdA Thioredoxin_2
Other DBs
NCBI-ProteinID: CBJ91606
UniProt: D3VA42
Position
3454602..3455000
AA seq 132 aa
MKKPGLLLLMGWMVSLSTGAKTVIYTDRQHPPVNLASGSQVVWLDAPEQFQQQYFAQLSA
DPRQAMKQAQTRLQSPQWREQEQQIINAWQHVIRGRALGVQKYPAVVFDDRDVVYGTADM
AKATALREQHQP
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaaaaaaccgggtttactgctcctgatgggatggatggtgtcactgtccaccggggcc
aaaacggtgatctataccgaccgtcagcacccgccggtaaatctggcgtcgggcagccag
gttgtctggctggatgcacctgaacaatttcagcagcaatactttgctcaactttccgca
gatccacgacaggcgatgaaacaggcacaaacaaggctgcaatcacctcagtggcgtgag
caggaacagcaaattatcaacgcatggcaacatgttattcggggcagggcactgggcgtg
cagaaatacccggcggtggtgtttgatgatcgtgacgtggtgtatggcacggccgatatg
gccaaagcgacagcgctcagggagcagcatcagccatga

DBGET integrated database retrieval system