KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3675
Entry
XNC1_3675         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: DUF3487
Other DBs
NCBI-ProteinID: CBJ91706
UniProt: D3VAT1
Position
3539620..3539994
AA seq 124 aa
MQTIPFLPDRLNAEPIVFRGFTTPEMGLAALLGLVFGLMVSLPFIPLAGWVMIPTGMLFM
PLLLISFGGRWLAQLKRGKPENYLWLTLEEKKRRLGIGDPALIIAAQGWSLRRSRLTHRN
GSLR
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcagacgatccctttcctgcctgatcgcttaaatgccgaaccgatcgtattccgggga
ttcaccacaccggaaatggggctggccgctttgctggggctggtgttcgggctgatggtg
agccttccttttatcccgttagccggctgggtcatgataccgacgggtatgctgttcatg
cccttgttattgattagttttggtgggcgctggctcgcgcagcttaagcgcggcaaaccg
gaaaattatctctggctgacgctggaagagaaaaaacgccggctgggtatcggtgatccg
gcattgattattgcggctcagggctggtcgttgcgccgaagcaggctgactcatcgtaac
gggagcctgcgatga

DBGET integrated database retrieval system