KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3678Help
Entry
XNC1_3678         CDS       T01274                                 

Definition
(GenBank) putative exported protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI ZapB Mod_r APG6_N OmpH
Motif
Other DBs
NCBI-ProteinID: CBJ91709
UniProt: D3VAT4
Position
3541470..3542900
Genome map
AA seq 476 aa AA seqDB search
MQVKSNSLVKILVPAVLMVGGFIGIKSCSSTDSTAPDTPQNNVLATLSPEELQALGVVGD
TPEDTLRTLVGTLNKVRAEQQRLGQQNADILKENDQLKNQRQDVAGQIDAAVAAIRQDDE
QRRRELQDEQQGLLAQIDLLTERLNATPLSAPDSPIPPGSGSIPYSANASTGQNELIWIT
PADEKPADIQTPGSGKATAQFPTSFLSEQSAAGQSKPQSPSLQNPSKEENEQPVYTLPEN
ATLVGSQAMTALLGRVPVNGTVTDPYPFKILIGKDNLTANGIELPEVEGAVVSGSASGDW
TLSCVRGQVNSITVVFQDGTVRTLPGSGQNNNTSANGIGWLSDENGIPCISGERKSNAAT
YLPTLFALSAMNSAGDALNESQRTAQTSGTGGITTALTGNAGQAALGKAMSGGMNDMSEW
LRQRYSQTFDAVYVPPGARVVVHITQRLAIDYETKGRKVRYGVRETAQRDNQEALD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttaaatccaacagtctggtgaaaattctggtgccggcggtgctgatggtcggc
gggtttatcggcatcaaaagttgcagttcaacagacagtaccgcacccgatacgccccag
aataatgtcctggccacgttgtcaccggaggagctacaggcgctgggtgtcgtcggcgat
acaccggaagatactctgcgtactctggtggggacgctcaataaagtgcgggcagagcag
cagcgtttaggtcagcagaatgccgatatcctgaaagaaaatgaccagttaaaaaatcag
cgtcaggatgtcgccggtcagatagacgcggcggtggcagctatccggcaggacgatgaa
cagcgccggcgtgaattacaggatgaacagcagggattgctggcacagattgatttactg
acagaacggctgaatgcaacgcctttgtctgcgccggacagtccgataccgcctgggtcg
ggaagtattccgtattctgccaatgccagcacagggcaaaatgaacttatctggataaca
ccggccgatgaaaagcccgcagacatacaaacccccggcagtggaaaagccacggcgcag
ttcccgacctcatttttaagtgaacagtcagccgccgggcaaagtaagccccaaagccca
tcgcttcaaaacccatcaaaggaagaaaatgaacagccggtctataccctgcctgaaaat
gccacgttagtcggcagtcaggccatgaccgcgttattaggtcgggtgccagttaatggc
acagtcaccgacccctatccgttcaaaatccttatcggcaaagacaacctgacggccaac
ggcattgaactgccggaggtggagggggcggtggtatccggctcggccagtggtgactgg
acgctttcctgcgtgcgcggtcaggttaattccatcacggttgtctttcaggatggcacg
gtgcgtaccctgccgggcagcgggcaaaacaacaataccagcgcgaacggcatcggctgg
ctgtccgatgaaaacggcattccctgtatcagcggtgaacgcaaatccaacgccgccact
tatctgccgacattgtttgcgctctcggccatgaattcggccggcgatgcgctgaacgaa
agccagcgtaccgcccagaccagcggcacaggcggtatcaccaccgcgttaacgggcaat
gccggacaggccgcattaggcaaagcgatgtcaggtggcatgaatgacatgagtgaatgg
ctcagacagcgttacagccagacgtttgatgcggtttacgtcccgcccggtgcccgtgtt
gtggtgcatatcacccaacgcctggcgattgattacgaaacgaaaggacgtaaggtgcgc
tacggcgtgcgtgagaccgcccaacgtgacaatcaggaagcattagattaa

DBGET integrated database retrieval system