KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3681
Entry
XNC1_3681         CDS       T01274                                 
Name
(GenBank) conserved hypothetical protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 AAA_10 FtsK_SpoIIIE HerA_C AAA_22 AAA_29
Other DBs
NCBI-ProteinID: CBJ91712
UniProt: D3VAT7
Position
3543645..3546422
AA seq 925 aa
MEKPKALNRPGKLREADETAIYHANPSIIDYLPWVEYLEKEQCLLLDDGISVGAVYRIEP
IATEGRPAARLTEIRDQLEDAIQDSLEEDDISPWVVQFFCQDDDDPADYLNTLRGYVKPW
AQGTPFTDAFLAESEHHLNSIARPDGIFQDSLITGQPWRGQQRQTRMVVYRWLPDVRRSP
VNHLTLSAVAVLNQVCERLVSSLASAGVIARRQHGGQIHRWLLRHFNPAPDWGMAKADFY
RTVSYEAPAQSDLPVSNDFAESLWFTPPVSDPDAGVWWFDNLPHKAIPVERLRRPPEPGT
LTGEVKRGDNINALMDMMPAGTVVSLTIVAQAQDRLEEDFTRLAKNAVGENTESLRVRQD
VQEVKELLGRRHKLYRSALTFLVRGKDVADLNHRVHQLSATLLTAGLQPVRPEFSVSPLN
TWLRALPMCFNPQKDKKHWHSRLAWVQHLAGLLPVTGRSTGTGHPGFSFFNRGGAPLTFD
PMNKQDRTQNAHLLLFGPTGAGKSATLCASLIQLMAIHRPRLFIVEAGNSFGLLADYYES
LGLTVNKIGIRPGCGVSLALFADAHQLLQLSPEQLRINEADIPETDEAQEEGDEQRDILG
EMEIAARLMITGGEKREEERLTRSDRGLIREAIMQAAQTSFDESRQMVASDLQNALYAIA
RNHRQDEHGQLLITAHRRARADEMASAMSMFTQGFEGELFNRPGTPWPEVDVTLIDLGTL
ARENYSAQMALAMVSLINKVNNLAERDQYQDRELQLVIDEGHITTTNPLLSPYMTKVVKM
WRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQIARFKKLTEEQKAVLL
SAGKLPRCYTEGVVLAKKIEALFRVVPPSLYLALGMTEKEEKAERRALMREHQCSELEAA
KLVARKMDIARGLKVNSELGRVDVL
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggaaaaacccaaagcactgaaccgccccggtaaactgcgtgaggcggatgaaaccgca
atttaccatgcaaacccttccatcatcgattacctgccctgggtggaatatctggaaaaa
gaacaatgcctgctgctggatgacgggatttccgtcggcgcggtctaccggattgaaccc
atcgccaccgaaggccgtcctgcggcgcggttgactgaaatccgggatcaactggaagat
gcgatccaggacagtctggaagaagatgatatttcgccgtgggtggtgcagtttttttgt
caggatgacgatgaccctgctgactatctcaacaccttgcggggctatgtgaaaccttgg
gcacagggaacgccgtttactgacgcctttctggcggaatcagagcatcacctgaacagc
attgcccggcctgacgggatatttcaggacagcttaatcaccgggcagccgtggcggggc
cagcagcgccagacccgcatggtggtttaccgctggctgcctgatgtgcgcagatcccct
gtcaaccatctgaccttatcggcggtggctgtgctcaatcaggtctgtgagcggctggtt
tcatcactggcttctgccggtgtgattgcccgccgacaacatggcgggcagatccaccgc
tggttgctgcgtcattttaatccggcgccggactgggggatggcaaaagccgatttttac
cgtaccgtcagttatgaagcccctgcacaatcggatctccccgtcagtaatgactttgcc
gaaagcctgtggttcaccccgccggtgtctgatcccgacgcgggcgtctggtggtttgac
aaccttcctcataaagccattccggtcgaacgactgcgtcgcccaccagaaccgggaaca
ctgacaggcgaagtgaaacggggcgacaatatcaatgccctgatggacatgatgccggca
gggacggtggtttcgctgaccattgtggcgcaggcgcaggaccgactggaagaggacttt
acccggctggcgaaaaatgcggtgggagaaaacactgaatcgctgcgcgtccggcaggat
gtgcaggaggtgaaggaacttctggggcggcggcataaactgtaccgcagtgcgctgacc
tttctggtgcggggcaaggatgtggctgacctgaatcaccgggtgcatcagttatccgcc
accctgctgacagcgggattacagcctgtccggccggaattcagtgtctcaccgctgaat
acctggttacgggcactgccgatgtgctttaacccgcagaaagacaaaaaacactggcac
agccgcctggcctgggtacagcatctggccgggttattgccggtgacaggccgttcgacc
ggcaccgggcatccggggttcagtttctttaaccggggcggggcaccgctgacctttgat
ccgatgaacaaacaggatcgcacccagaatgcccacctgctgttatttggcccgaccggc
gcggggaaatctgccacattgtgcgcctcgctcatccagttgatggcaatacaccggccg
cgcctgtttattgtcgaagccggcaacagctttggcctgctggctgattactatgagagt
ctggggctgacggtgaataaaatcggcatcagaccgggctgtggcgtcagtctggccctg
tttgccgatgcccatcaactgctgcaactgagtcctgagcaattgcgcattaatgaagcc
gatattcctgagacggatgaagcacaggaagaaggcgatgaacagcgcgatattctgggc
gaaatggaaattgccgcccgactgatgatcaccggcggtgagaaaagagaagaagagcgc
ctgacccgctctgatcggggtttaattcgtgaggccattatgcaggcggcacagaccagc
tttgacgagtcccgccagatggtggcttcagacttacaaaatgcgctttatgccatcgcc
cgtaatcatcggcaggatgagcacggtcagctgttaatcacagcccatcgacgggcacgg
gcagatgaaatggccagcgccatgtcgatgtttacgcagggattcgagggtgaactgttt
aaccgtcccggtacgccgtggccggaagtggatgtcaccctgattgatttgggcacactg
gcgcgggagaactactcggcacaaatggcactggcgatggtctcgctgattaacaaagtc
aataatctggctgaacgggatcaatatcaggatcgcgaactgcaactggtgattgatgaa
gggcatatcaccacgaccaacccgctgttatcaccctatatgaccaaggtggtgaaaatg
tggcgtaagctcggtgcctggctgtggctcgccacccaaaacctggcagattaccctgat
accgctgaaaagatgctgaatatggccgaatggtggctgtgtctgaccatgccaccggat
gaagtggagcaaatcgcccggtttaagaaactgacggaagagcaaaaagcggtgctgctt
tctgccggtaaactgccccgctgttataccgaaggcgtcgtgctggcgaaaaaaattgaa
gccttatttcgggtggtcccaccgagcctctatctggcgctggggatgacagaaaaagaa
gaaaaagcggaacggcgggcgttaatgcgggaacatcagtgcagtgagctggaagccgcg
aagttggtggccagaaaaatggatattgcgcggggattgaaggttaattctgagctaggg
cgtgttgacgttttatga

DBGET integrated database retrieval system