KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3719Help
Entry
XNC1_3719         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K19046  CRISPR system Cascade subunit CasB
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:xne02048]
    XNC1_3719
Prokaryotic defense system [BR:xne02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-E factors
    XNC1_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRISPR_Cse2 DUF4693
Motif
Other DBs
NCBI-ProteinID: CBJ91750
UniProt: D3VAX5
Position
3585011..3585562
Genome map
AA seq 183 aa AA seqDB search
MNSLFESCVIPWWESMFLTQDELKKKKIRPAPTLYKAQLKRCQDIDSVTWAEGFRALWFS
LPENVTEKAEQKNITLWAMIAVTLVYVKTNTTTNLATAAGTKTENDKPIVSAHRFAQLQA
ARTPDEFIMRLRRVLQQLDGKVSVLSLANDIDQWMKEYHQSRPNRANKRLCVQWAMDYYK
AAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcctgttcgaaagttgcgtaataccttggtgggagagcatgttcttgacccaa
gacgaattgaagaaaaaaaagattcgacccgcaccgacgctttacaaagcacagttaaaa
cgctgccaggatatcgattcagtcacatgggctgagggctttcgcgctttatggtttagt
ttgcctgaaaacgttactgaaaaagctgaacaaaagaatataacgttatgggcaatgatt
gccgttacccttgtgtatgtaaaaaccaacacaaccaccaatctggcaaccgctgcgggc
accaaaacagaaaatgacaaaccgattgtcagcgcacatcgctttgcccagttacaagcc
gccagaacgccggatgaatttattatgcgattgcgacgcgtcctgcaacaactggacggc
aaagtttctgtgttatccctcgccaacgatattgaccaatggatgaaggaatatcaccaa
tccagacccaatcgcgccaataaacgcctttgtgtgcaatgggcaatggattactacaaa
gcagccaaataa

DBGET integrated database retrieval system