KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3787Help
Entry
XNC1_3787         CDS       T01274                                 

Gene name
ileS
Definition
(GenBank) isoleucine tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xne00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XNC1_3787 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_3787 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_3787 (ileS)
Enzymes [BR:xne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     XNC1_3787 (ileS)
Amino acid related enzymes [BR:xne01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XNC1_3787 (ileS)
Transfer RNA biogenesis [BR:xne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XNC1_3787 (ileS)
 Prokaryotic type
   Other AARSs
    XNC1_3787 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e zf-FPG_IleRS tRNA-synt_1f tRNA-synt_1_2 TEX12
Motif
Other DBs
NCBI-ProteinID: CBJ91818
UniProt: D3VB43
Position
3642427..3645240
Genome map
AA seq 937 aa AA seqDB search
MSDYKDTLNLPETGFPMRGDLAKREPDMLKRWYKEELYQAIRKAKSGKKTFILHDGPPYA
NGNIHIGHSVNKILKDIVVKSKGLSGYDSPYIPGWDCHGLPIELKVEQIIGKPGEKFSAA
EFRAECRKYAMTQVEAQKADFKRLGVLGDWDKPYLTMDFKTEADIIRALGRIIKNGHLLK
GVKPVHWCTDCGSSLAEAEVEYYDKTSPSIDVSFNAVDADAVYAKFGVKPQGLPVSLVIW
TTTPWTLPANRAIALGAEITYQLVKIDHEYLILAAELVEQVMQRAGITSWEVVSDCTGAD
LELMRFNHPFMGFDAPAILGDHVTLEAGTGAVHTAGGHGPDDYSISLKYGLEIANPVGPN
GCFISGTYPSLDGQFVFKANDIIVELLKEKGALLSLHKIQHSYPCCWRHKKPIIFRATPQ
WFISMDKNGLRTQSMKEIKDVQWIPGWGQARIESMVENRPDWCISRQRTWGVPMSLFIHK
ETQEPHPRTVELIEEVAKRVEIDGIQAWWDLDATELLGNEAADYIKAQDTLDVWFDSGST
HSSVVDVRPEFSGNSADLYLEGSDQHRGWFMSSLMLSTAIKGKAPYRQVLTHGFTVDEQG
RKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTGEIAVSDEILKRSADAYRRIRNTAR
FLLANLNGFNPEQHKVKAEDMVVLDRWAVGRAQAAQANILKYYDEYDFHSVVQRLMQFCS
VEMGSFYLDIIKDRQYTAKGDSLARRSCQTALFHIAEALVRWMAPIMSFTADEVWNELPG
ERAKYVFTEEWYEGLFGLADGEDMNDTFWATLLEVRGEVNKVLEQARADKHIRSSLEAAV
TLYADEALAEKLNKLSDELRFVLLTSQAEVAAYVAAGDDAQQSELAGLKVAFRKANGEKC
PRCWHYATNVGVVAEHAELCGRCVTNVAGNGEERKFA
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactataaagacaccctgaatttaccggaaacagggttccctatgcgcggggat
ttagccaagcgcgaaccagatatgttaaaacgttggtacaaagaagagttgtatcaggca
atcagaaaagcaaaatctggcaagaaaacctttattttgcatgatggccctccttatgca
aatggcaatattcatattggtcactcagttaataaaattctcaaagatattgttgttaag
tccaaaggattatcaggctacgattcgccttatattccgggttgggactgccacggttta
cccattgagctcaaggttgagcaaattatcggtaaaccgggggaaaaattttccgccgct
gaattccgtgctgaatgccgcaaatatgccatgactcaggttgaggcacagaaagcggac
ttcaaacgtctgggcgttctgggcgactgggataaaccttacctgacaatggacttcaaa
actgaagcagacattattcgtgcattgggtcgcatcatcaaaaatggtcatttgctgaaa
ggcgtgaaacccgttcactggtgtactgactgtggttcctccctcgctgaagcagaagtg
gaatattacgataagacctctccttccattgacgtgagcttcaacgctgttgatgctgat
gccgtgtatgccaaatttggcgttaaaccacagggtctgcccgtttctctggtcatctgg
acaaccacaccgtggacattgcctgctaaccgtgccattgcattaggcgcagaaatcacc
taccagttagtcaaaattgatcatgaatacctgattctggcagctgaactggtcgagcag
gttatgcagcgtgccggtattacgtcatgggaagtcgtcagtgattgtactggcgccgat
ctggaactgatgcgcttcaatcacccattcatgggcttcgacgctcccgccatcctcggt
gatcacgttacgcttgaagccggtacaggtgctgtgcataccgctggtggtcacggtccc
gatgactactccatcagtctgaaatatggtcttgagattgccaacccagttggcccgaat
ggctgcttcatttctggtacatatccttcactggatggtcagtttgtcttcaaagcgaac
gatatcatcgttgagctgttgaaagaaaaaggtgcactgctgagtctgcacaaaatccag
cacagctatccttgttgctggcgccacaaaaagcccatcatcttccgtgcaacaccacaa
tggtttatcagcatggataaaaacggcctgcgtactcagtcaatgaaagagatcaaagac
gttcagtggataccgggttggggacaggcccgcattgagtccatggtagaaaaccgtcct
gactggtgtatctcccgtcagcgcacatggggtgtaccaatgtctctgtttattcataaa
gagactcaggaaccccatccacgcaccgtagaattgatcgaagaagtcgctaaacgtgtt
gaaatcgatggtattcaggcatggtgggatctggacgccacagaactgctgggtaatgaa
gccgctgattacattaaggctcaggatacactggatgtctggtttgactcaggaagtacc
cactcttccgttgttgatgtccgtccggaattcagcggcaactctgccgatctctatctg
gaaggctctgaccagcaccgtggctggttcatgtcctcattgatgctgtctacggcgatc
aaaggcaaagcaccttaccgtcaagtactgactcatggtttcaccgttgatgagcaaggg
cgcaagatgtccaaatccattggtaatactgtcagtccacaagatgtgatgaacaagctg
ggtgcggatatcttgcgtttatgggtagcatctaccgattatactggtgaaatcgcagtt
tcagacgagatcctgaaacgctcagccgacgcttaccgccgtatccgcaacaccgctcgt
ttcctgctggcaaacctgaatggtttcaacccagagcagcataaggtaaaagccgaagat
atggtggttttggatcgctgggcagtaggtcgtgctcaggcagcacaagcgaatatcctc
aaatactatgatgaatatgatttccactctgtggttcagcgtttgatgcaattctgttcc
gtggaaatgggttctttctatctggatatcatcaaagatcgtcaatacactgcgaaaggc
gacagccttgcccgtcgcagttgccagaccgcattgttccatatcgcagaagcactggtt
cgctggatggcaccaattatgtcgttcactgcggatgaagtctggaatgaattgccgggt
gaacgtgctaaatatgtctttaccgaagagtggtatgaaggtctgttcgggctggcggat
ggcgaagacatgaacgatactttctgggcgactctgctggaggtacgcggcgaagtcaat
aaagttctggaacaggcccgtgctgataaacatatccgcagttctctggaagcggctgtc
acactctatgcagatgaagcgctggcagaaaaactcaacaaactgtctgatgaattgcgt
tttgttttgctgacatctcaggctgaagtggctgcttatgtcgcggcaggtgatgacgct
cagcaaagcgagcttgcgggtctgaaagtggccttccgcaaagcaaacggagagaaatgt
ccgcgttgctggcattatgcgacaaatgtgggcgtggtagcggaacatgcagaactttgc
ggccgctgtgtgactaacgttgccggtaacggtgaagagcgtaaatttgcctga

DBGET integrated database retrieval system