KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3880Help
Entry
XNC1_3880         CDS       T01274                                 

Gene name
hemB
Definition
(GenBank) 5-aminolevulinate dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00860  Porphyrin and chlorophyll metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
Module
xne_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
xne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNC1_3880 (hemB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xne04147]
    XNC1_3880 (hemB)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     XNC1_3880 (hemB)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XNC1_3880 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CBJ91908
UniProt: D3VBR9
Position
complement(3739430..3740446)
Genome map
AA seq 338 aa AA seqDB search
MSDVFPGAFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGSNQCQEVPSMPGVY
RLTIDLLLKEAEEIARLGIPVLSLFPVIEADKKSLDAKEAYNPDGLIQRSVRALKDAVPE
LGLLTDVALDPFTVHGQDGVIDQDGYVINDVTKEILVKQALSHAEAGAEIVAPSDMMDGR
IGAVRDQLESEGHINTQIMAYSAKYASCYYGPFRDAIGSSGNLKGGNKMTYQMDPANGDE
ALQEIAQDLQEGADSVMVKPGMPYLDVIRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
KEQPTIMESLVCFKRAGADGVLTYFAKRVAQWLHEQKY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtatttcccggcgcatttcccggtcgccgtatgcgccgtgtacgacgccat
gatttttcccgccgtttagttgctgagaatcagcttactgtcaatgacctgatttatcct
gtctttgtcatggaagggagtaatcaatgtcaggaagtgccttcaatgccaggagtgtat
cgtctgacaatcgatcttttgctgaaagaagccgaagagattgcccgactgggtattccg
gttttatcgctgtttcctgtcattgaagcggacaaaaaatcattggatgcgaaagaagcc
tataacccggatggcttgattcagcgttctgttcgtgcgctgaaagatgctgtacctgaa
ctggggcttttgactgatgtggctttggacccattcactgttcacgggcaggatggtgtt
attgatcaggatggctacgttatcaatgacgttaccaaagagattttggttaagcaggca
ttatcccacgccgaagcgggtgctgaaattgttgcgccaagcgatatgatggatggtcgt
attggtgctgttcgggatcagcttgagtctgaggggcatatcaatactcaaatcatggct
tactcagccaagtacgcttcttgttactatggaccgttcagggatgcgattggttccagt
ggtaatttgaaaggtggcaataaaatgacctatcaaatggacccggccaacggtgatgaa
gcgttgcaggaaatcgcacaggatttgcaggaaggtgcggatagtgtcatggtgaaaccc
gggatgccctatttggatgtgatccgccgggtaaaagatacttttggtgtgccgacattc
gcttatcaagtttccggcgaatatgcgatgcacatggctgccattcaaaacggctggttg
aaagaacagcctacgattatggaatcactggtgtgtttcaaacgggcaggagcagatggt
gtgctgacttattttgccaagcgggttgcacagtggttgcacgagcaaaagtattaa

DBGET integrated database retrieval system