KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3909Help
Entry
XNC1_3909         CDS       T01274                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00052  Galactose metabolism
xne00500  Starch and sucrose metabolism
xne00520  Amino sugar and nucleotide sugar metabolism
xne00521  Streptomycin biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xne_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_3909 (glk)
   00052 Galactose metabolism
    XNC1_3909 (glk)
   00500 Starch and sucrose metabolism
    XNC1_3909 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XNC1_3909 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XNC1_3909 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XNC1_3909 (glk)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XNC1_3909 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CBJ91937
UniProt: D3VBU8
Position
3770763..3771731
Genome map
AA seq 322 aa AA seqDB search
MTTYALVGDIGGTNARLALCDVDTGQQSAVEFYPCAHYESLEIVIRQYLQKQNCEVKYGC
IAIACPVTEDVISMTNHSWRFSVSQMKASLQWERFEVINDFTAVSLAIPVLGANDVIQIG
GKQPQAKRPIAVYGAGTGLGVAHLIHTGNQWMSLPGEGGHVDFAPDSVEEDHMLNVLRKE
YGHVSAERILSGPGLVNIYRSLMTLNGQPIEVLTPSDISDRALSGNCPICKHALELFCSA
LGRFGGNLALNIGAFGGVYIAGGIVPRFLDFFQKSAFRKAFESKGRFTNYLQDIPVYLIT
HDKPGLLGTGSYIRQSLGKTIG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatgccctggtaggcgatatcggcggtacaaatgcacggctggcattatgt
gatgtagatactgggcaacagagcgcagtcgaattctatccctgtgcgcattacgaatca
cttgaaattgttattcgccaatacctgcaaaaacagaactgtgaagtcaaatatggttgt
atcgccattgcctgtccggtgacagaagatgttatcagtatgaccaatcatagttggcgt
ttctctgtcagccaaatgaaagcatctctgcaatgggagcgttttgaggtcatcaacgat
tttaccgcggtttctctcgccattccggttctgggggcaaatgacgtgatccagattggt
ggaaaacagcctcaggctaaacgacccatcgcggtttatggtgcaggaacagggttgggc
gtcgcacatcttattcacacaggaaatcaatggatgagcctgcccggtgaaggtggtcat
gtcgattttgcgcctgatagtgtggaagaagatcatatgctgaatgtattgcgcaaagaa
tacggtcatgtctccgctgaacgcatcctttcagggcctggattggtcaatatctatcgt
tctctgatgacactgaatggtcaaccaatagaagtacttaccccgagcgacatttccgat
cgtgccctgagcggaaactgccctatctgcaaacatgcactggaactattctgctcggca
ctgggtcgttttggcgggaatctggcactgaatattggcgcatttggtggtgtttatatt
gcaggtggtattgtcccgcgcttccttgatttcttccaaaaatcggcgttccgcaaggca
tttgaaagcaaaggccggtttacaaattatttgcaggatattcctgtttatctgattacc
cacgataaacccggattattgggtacgggttcttacatccgtcaatcgctgggtaaaacg
attgggtaa

DBGET integrated database retrieval system