KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4026Help
Entry
XNC1_4026         CDS       T01274                                 

Gene name
ygdE
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase, SAM-dependent domain
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xne03009]
    XNC1_4026 (ygdE)
Enzymes [BR:xne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     XNC1_4026 (ygdE)
Ribosome biogenesis [BR:xne03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XNC1_4026 (ygdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN MIT_C
Motif
Other DBs
NCBI-ProteinID: CBJ92051
UniProt: D3VCL6
Position
complement(3888742..3889839)
Genome map
AA seq 365 aa AA seqDB search
MNKVALYCRPGFEKECAAEITDKAGKKEIYGFARVKENSGYVLFECYQVDDADRLIREIP
FSELIFARQMLVVGELLKDLPQEDRITPIMGMLMGVIERAGELRVEVPDTNESKELMKFC
RKFTVPLRNAMRQEKLLLTKENPNRPVIHVFFIAPGCCYVGYSYSNNNSRFYMGIPRLKF
PSDAPSRSTLKLEEAFHVFIPYDEWEERLDSGLHAVDLGACPGGWTYQLVKRSMLVHAVD
NGTMAESLMETGQVKHHRADGFKFEPSAKNIYWLVCDMVEKPAKVAQLMTDWLVKSWCRE
TIFNLKLPMKKRYEEVAHILQKMEQQLKENGVNAQIQAKHLYHDREEITVHVRRIWSVYA
PNRDY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtagctttatattgccgtccgggttttgaaaaagagtgtgcggcagaaatt
accgataaggcgggtaagaaagaaatttacggtttcgcccgtgtgaaagaaaacagcgga
tatgtgctgtttgagtgttatcaggtggatgatgcagatcgtctgatccgtgaaattccg
ttcagtgagttgattttcgcccgccaaatgctggtcgtgggggaactgctgaaagattta
ccgcaagaagatcgcattacgccgattatgggtatgctgatgggtgtgattgaacgggcg
ggtgagctgcgtgtagaagtaccggataccaatgaaagcaaagagctgatgaaattctgc
cgtaagtttacggtgccgctgcgtaacgcgatgcgtcaggaaaaactcttgctgacaaag
gaaaatcccaaccgtcccgtgatccatgtcttcttcattgcaccgggttgctgttacgta
gggtattcctacagtaataacaattcccgtttttatatgggtatccctcgcctgaaattc
ccgtcagatgccccaagccgctcaacattgaaacttgaagaggcttttcatgtctttatt
ccttatgacgagtgggaagagcgtctggacagcggccttcatgcggtagacctgggggct
tgtccgggcggttggacttaccagcttgtgaaacgcagtatgttggttcatgcggtggat
aatggcacgatggctgagagtttgatggaaacaggtcaagtgaagcatcatcgtgcggat
ggtttcaaatttgaaccgtcagcgaagaacatttattggttggtttgtgacatggttgag
aaaccagccaaagttgcacaattgatgacggactggttagtaaaaagctggtgtcgtgag
acaattttcaaccttaagctgccgatgaaaaagcgctatgaggaagttgcacatatattg
cagaaaatggaacagcaactaaaagaaaatggtgttaatgctcaaattcaggctaaacac
ttgtatcacgatcgcgaggaaatcacggtacatgttcgccgcatttggtctgtgtatgca
cctaaccgagattattga

DBGET integrated database retrieval system