KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4047Help
Entry
XNC1_4047         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xne00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XNC1_4047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_4047
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xne03016]
    XNC1_4047
Enzymes [BR:xne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     XNC1_4047
Amino acid related enzymes [BR:xne01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   XNC1_4047
Transfer RNA biogenesis [BR:xne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    XNC1_4047
 Prokaryotic type
    XNC1_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_SAD KH_1
Motif
Other DBs
NCBI-ProteinID: CBJ92072
UniProt: D3VCN7
Position
complement(3915655..3916494)
Genome map
AA seq 279 aa AA seqDB search
MTGQLSLDAVVIDIFKYNDGYIVITDNSPFYPENYKWGDQKSDVGVIEFNNHILNIVKTY
TAAVIDGQIYIDQNIPDKLNAEDKLIPAHYLESLNGLEDKFILGENIKLSVDAETRHKIS
AAHSMAHFMSLALNKAANKYWNKGYETDSLGNFNLDKAAIFKSSISELKSIDIYRFGKSI
KKKGFDKSSFMENIDSTSEEINLILKNWLSIGSEIQVEYTSKNIEDLRLWKSTVENKPVV
IPCGGTHIKNIEEIKDVKVEISQGESDEYIVIITHCTLR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccaattgagcctggatgctgtagtcatcgacatattcaaatataatgatggt
tatattgttattacggataatagccctttttatcccgaaaattataaatggggagatcaa
aaaagtgatgttggagtaatagaatttaataaccacatattaaatattgtcaaaacctat
actgcggcagtcattgacgggcagatttatattgaccagaatatacctgataaattgaat
gcagaagataaacttattccagcacactatttagagtcgttaaatgggctggaagataaa
tttatcttaggtgaaaatattaaattatctgttgatgctgaaaccagacataaaatcagt
gccgcgcatagcatggcacattttatgtctttagccttaaacaaggcggctaataaatat
tggaataaaggttatgaaacggatagcttaggaaattttaacctggataaggcagcaata
tttaaatcatcaatttctgagttaaaatcaatagatatatataggtttggtaagtccatc
aagaaaaaagggtttgataaatcttcatttatggagaacattgacagcaccagtgaagaa
ataaacctcattcttaaaaactggctttcaatagggagtgaaatacaggttgaatatact
tcaaaaaatattgaagatttgcggttgtggaaaagtactgtagagaataagcctgttgtg
attccatgtggtggaactcatataaaaaatatagaagaaataaaggatgttaaggtagaa
ataagccagggagaaagtgatgaatacattgtaatcataacacattgtacattgagataa

DBGET integrated database retrieval system