KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4336Help
Entry
XNC1_4336         CDS       T01274                                 

Gene name
argD
Definition
(GenBank) acetylornithine transaminase (NAcOATase and DapATase), PLP-dependent
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00220  Arginine biosynthesis
xne00300  Lysine biosynthesis
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01210  2-Oxocarboxylic acid metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
xne_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    XNC1_4336 (argD)
   00220 Arginine biosynthesis
    XNC1_4336 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_4336 (argD)
Enzymes [BR:xne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     XNC1_4336 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     XNC1_4336 (argD)
Amino acid related enzymes [BR:xne01007]
 Aminotransferase (transaminase)
  Class III
   XNC1_4336 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CBJ92358
UniProt: D3VEA7
Position
4165880..4167160
Genome map
AA seq 426 aa AA seqDB search
MTVISLGCGKYKNKVGEVADKTGESLSLYDQVMLPVYAPASFIPVSGKGSRVWDQQGNEY
IDFAGGIAVLALGHCHPALVDTLKQQGEKLWHVSNVFTNIPALTLAQKLIDATFAQKVFF
ANSGAEANEAAFKLARRYAITRHHPNKTKIIAFHQAFHGRTFFTVSVGGQSKYADRFGPK
PADIVHVPFNDLDAVRAAIDEYTCAVVLEPIQGEGGITPATKEFLRGVRELCDKYQALLV
FDEVQSGMGRTGKLYAYQHDGIVPDILTTAKALGGGFPISAMLTTDAIAVAMETGAHGTT
YGGNPLACSVGCAALDIINTPEVLAGVEKRHDMIIHALKNLNQKYGIFQEFRGKGLLIGA
VLKAKYQGKSKEILQQSVEHGLMLLSAGDNVLRFTPSLIIPEEDIAEGMALLDIAIAQWL
NKSVVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgactgttatttcacttgggtgtggcaaatataaaaacaaggtgggggaagtggcagat
aagacaggagaaagcttaagtctctacgatcaggtgatgttgccggtttatgcaccggca
agttttattccggtcagcgggaaaggcagtcgggtatgggatcaacagggcaacgaatat
atcgattttgccggtggcatcgctgttttggcgctggggcattgtcatccggcgctggtg
gataccctgaaacagcagggtgaaaaattatggcatgtcagcaacgtcttcacaaacata
cctgctttgaccttagcgcaaaaattaattgatgcgacgtttgcacagaaggtcttcttt
gctaactcaggggcagaagccaatgaagcggcatttaaattagctcgccgttacgcgatc
acacgccatcatccgaataaaaccaagatcattgcttttcatcaggcgttccacgggcgg
acattttttaccgtttcggtaggcggacaatcaaaatatgctgataggtttggccccaag
ccggctgatattgtccacgttcctttcaatgatctggatgcggtcagggcagcaatagat
gagtacacctgtgctgttgttttagagccaattcaaggagaagggggaattactccggca
acaaaggaatttttgcgcggagttcgtgagttgtgtgataaatatcaggcactgttagtc
tttgatgaagtccagagtggtatggggcggacaggaaagttatatgcttatcagcatgat
gggatcgtacctgatattttgacgaccgcgaaagcactgggaggcggatttcctatcagt
gcgatgctaacgacagatgccattgcggtagcaatggaaacgggagcacacggaacaact
tatggtggcaatcctctggcttgttctgtcggttgtgcggcactggatattatcaatacg
ccggaagtgttggccggggtggaaaaacgccatgatatgatcatccacgcattgaagaac
ctgaaccagaaatatggcatcttccaagagtttcgtggaaaagggctgcttatcggtgct
gtattaaaagcgaaatatcagggtaaatccaaagagatattgcagcaatcggtggaacac
gggctgatgttattgagcgcgggggataatgtattgcgctttactccatctttgattatt
cccgaagaggatatagcggaagggatggcactgctggatattgcgatcgctcagtggctg
aataaatcagtcgttaaataa

DBGET integrated database retrieval system