KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4539Help
Entry
XNC1_4539         CDS       T01274                                 

Definition
(GenBank) Conserved hypothetical protein (probable component of SST VI cluster)
  KO
K11891  type VI secretion system protein ImpL
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xne00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XNC1_4539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_4539
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_4539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C EABR DUF4131 HisKA
Motif
Other DBs
NCBI-ProteinID: CBJ92561
UniProt: D3VFA4
Position
complement(4338297..4341902)
Genome map
AA seq 1201 aa AA seqDB search
MKWPSLSSLAPLKSALPALGKFKSLPRFKATMAVVLALIPCLLLIAVWWWGQEWKIRNDY
PLESLAARWLATAIIIMVVLVWIGMKAWHRLRTLEKLNLDVELKVVDPVRVDIEHQDRYL
EHWKSQLQRHLDSYNYLYERPWYMVVGSQKSGKTSLIKEGYKLSEIAAPEYLRQDDNIPL
MLHCWLGEKAVIIDPKGQLIDQPVPLNSDKPQINSRLWEAMLNWLAENRQRQPLNGIILT
VDTLRLLTDNREQRERYVRELHQRLQDIRLTFHSQLPLYLVMTKIDLLHGFEAMYQSLDR
KLRDQILGVTFSLNNRDEKAWRSELEQFWQQWMNNLNNAMPDMMLNNVDANQRSALFSFT
RQIQGLYSYVVQMLEDILYNDEHHRPTLRGVYLTSAHQVGQMDDLFTQSASAQYHLGSQA
FPTWPAGDTLPYFTHSLFEDVLLAEPNLAAENRIWLSRNRRQLYTFSTLSALVIMAMWGG
WHYFYQKNYRAGEEVLAQAKNFLSVPPPKGDDRYGDLQLSQLNPIRDATLAYGNYHENAS
FLTDMALYQGGSVGPYVATTYRKLLEQRFLPALMLGLLDDLNQAPASSEEKLEILRVMRM
MEDKSQRNSALVAQYMRERWSKAFHGQRNIQDALLTHLDYALDRTDWKELRDKGDKEAIT
NFAPFVKPIRQAQDELKALSVKQRVYQNLRIRAQDVLSAPLNLRDQIGPSFDDVFVASNE
KRLVIPQLLTRHGLMDYFVRQKDELTKLTEMDSWVLNIAKNNQDKASEAGLQNNDQYSTK
DQERILNDINDLYLSEYTATWRAAMNNLEVRDFDDLPHAISAIEQVISGEQPIKRALQIL
SDNTNPPLADNALSEKQKEDWLKQHDYRLLNRISHDFAQETEVLVERGDKGSTLQSVYQK
LTALHRYLLAIQNSPVPGKAALQAVQMRLDKNNSDAIFEVQQMAKTLPEPLNRWVGELAE
QAWRVVMMEAIRSLEVEWNDSVVKQYKTYLAGRYPFNPNATEEVPLSEFERFFRPDGTLD
TFYQQSLKPFVEYNLTTGTDGKALIRPDVMKQLELANRIRTTFFTPQNGLGAQFAIEPLS
LTGNKRRALLNLDGQLVDYSHGRSNVARLIWPNSMRAGTESKLTLMPDRSNLAPRSLSFM
GPWAQLRLINSGKLTNVQPGFFDVRFSVDGGDMTYRVYVDESDNPFAGGLFSQFKLPDTL
Y
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggccctctttgtcatctttggcacctttaaaatcagccttgccagcgctggga
aaatttaaatccctgcctcgctttaaggctacgatggcggtggttctggcactgattccc
tgcctgctcctgatcgccgtctggtggtggggtcaggaatggaaaatccgcaacgattat
ccgctggaaagccttgcggcccgctggctggcaaccgccatcatcatcatggtggtgttg
gtctggatcggcatgaaagcatggcaccgcttacggacactggaaaaactcaacctggat
gtcgaactgaaagtcgttgatccggtgagagtggatattgaacatcaggatcgctatctc
gaacactggaagtcccagttgcaacgccatctggattcatacaattatttgtatgaacgc
ccgtggtatatggtggtcggcagtcaaaaaagcggcaagacttcgctgattaaggaaggc
tataagctgtctgaaattgcggccccggaatatttgcgtcaggatgataacatccccctg
atgttgcactgctggttaggggaaaaagcggtcattattgacccgaaaggccagttgatt
gatcaaccggttccgcttaacagtgacaagccccaaatcaatagccgcctgtgggaagcc
atgctgaattggttggctgaaaaccgccagcgccagccactcaacggtattattctgacc
gtggataccctgcgtctgctgactgataaccgcgagcaacgtgaacgctatgtgcgggaa
cttcaccagcgtctgcaagacattcgcctgactttccacagccagttgccgctttatctg
gtgatgaccaaaatcgacctgttgcacggttttgaagccatgtaccagtcactggatcgc
aaattgcgtgaccagatcctcggggtcacattcagcctcaacaaccgggatgaaaaagcg
tggcgcagtgagctggagcagttctggcaacagtggatgaacaacttgaacaacgcgatg
ccggacatgatgctgaacaacgtggatgccaaccagcgcagcgccctgttcagtttcacc
cgtcagattcaggggttgtacagctatgttgtccagatgctggaagatattctgtataac
gacgaacatcaccgcccgaccctgcgcggagtgtacctgacttccgcacatcaggtcggg
cagatggatgacttgttcacccaatccgcttcggctcagtaccatctgggttcacaggcg
ttcccgacatggccggcgggcgataccctgccgtactttacccattccctgtttgaagac
gtgctgctggccgagccgaatctggcggcggaaaaccgtatctggctgagccgcaaccgc
cgtcagttatataccttctccaccctcagtgccctggtcattatggcgatgtgggggggc
tggcattacttctaccagaaaaactaccgggcgggtgaagaagtgctggcgcaggcgaaa
aacttcctgtccgtgccgccgccgaaaggggatgaccgttatggcgatctccagttgtca
caactgaacccgatccgtgacgcaacgctggcctatggtaattatcatgaaaatgcttct
ttcctgacggacatggcgctgtatcagggtggcagtgtcgggccttatgtggcaactacc
tatcggaaattgctggaacagcgtttcctgcccgccctgatgctgggtctgctggatgat
ctgaatcaggcccccgcgagcagtgaggaaaaactcgagatcctgcgagtgatgcgcatg
atggaagataaaagtcagcgtaacagcgctttggtcgcccagtatatgcgtgagcgctgg
agtaaggccttccacggccagcgcaatatacaggatgcgttgctgacccatctggattac
gcccttgatcgaaccgactggaaagagttgcgtgacaaaggcgataaagaggccataacc
aacttcgccccgtttgtcaaaccgatccggcaggcgcaggatgagctgaaagcgctctcg
gtcaagcagcgggtttaccagaacctgcgtatccgggcacaggatgtcctgtcggcaccg
cttaacctgcgtgaccagattggcccgagctttgatgatgtgtttgtcgccagcaatgaa
aaacggctggtgatcccgcagttactgacccgccacgggctgatggattacttcgtccgg
caaaaagatgaactgacgaaactgaccgagatggacagctgggtgctgaacatagcgaag
aataatcaggacaaagccagcgaggcgggtttgcagaataacgaccagtacagcaccaaa
gatcaggagcggatactgaacgatatcaatgacctgtatttgtccgagtataccgccacc
tggcgggcggcgatgaacaacctcgaagtgcgggattttgatgatttgccccacgccatc
agtgccattgaacaggtgatcagtggcgagcaacccatcaagcgggcgctgcaaatcctg
agtgataacaccaacccgccgctggcggacaacgcgctgagcgaaaaacagaaagaagat
tggctgaaacaacacgattaccgcctgttaaaccgtatcagccacgacttcgcgcaggaa
acggaagtgctggtggaacgcggcgacaagggcagtacgctgcaaagcgtctaccagaaa
ctgaccgccttgcaccgttacctgctggcgatccagaactcgcctgtcccgggcaaagcc
gccctgcaagcggtgcagatgcgtctggacaaaaacaacagtgacgcgatttttgaagta
cagcagatggcgaaaaccttgccggagccgctgaaccgctgggtcggcgaactggcggaa
caggcctggcgggtggtgatgatggaggcgatccgttcactggaagtggaatggaacgac
tctgtggtgaaacagtacaagacttatctggcgggacgttatccgttcaaccccaacgcg
accgaagaagtgccgctgagcgagtttgaacgcttcttccggccagacggcacgctggat
accttctaccagcagagcctgaaaccgtttgtggagtacaacctgaccacggggacggac
ggcaaggcgctgatccggccggacgtgatgaaacagctggaactggcgaaccgcattcgc
accaccttctttaccccccaaaacgggctgggggctcagtttgccatcgaaccgctcagc
ctgaccggcaacaagcgccgggccttgctgaacctggatggccagctggtggattactcc
cacggccgcagtaacgtggcccgtcttatctggcctaactccatgcgagccggaaccgag
agcaagctgaccctgatgccggatcgcagcaatctggcgccgcgctccctcagtttcatg
ggcccgtgggctcagttgcggctgatcaacagtggcaagctgaccaacgtccagccgggc
ttctttgacgtgcgctttagtgtggatggcggcgacatgacctaccgtgtctacgtggac
gaatcagacaacccctttgctggcgggctgttcagccagttcaaactaccggataccctc
tattaa

DBGET integrated database retrieval system