KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4549Help
Entry
XNC1_4549         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein (probable component of the SST VI cluster)
  KO
K11895  type VI secretion system protein ImpH
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_4549
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_4549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG nos_propeller
Motif
Other DBs
NCBI-ProteinID: CBJ92571
UniProt: D3VFB4
Position
complement(4351521..4352573)
Genome map
AA seq 350 aa AA seqDB search
MAGTDRSTLVDVITEQGLATPLALDISQYNFYQLVELLNQLAIAWEKTGETDRPDLESVR
FRSSARLAFPTRDVISLAQSKRGYFELEVSFMGLHGSQSPMPGYYLDSLAWEDAQGENRL
TDFLNLFNHRLITLLHQIWRKYRYYIYFKKGGEDSFSQRMFSLVGLGSDINRRMLNINHS
KMLAYAGLLASPGRSPEVICSLVSHCFDLQDVTLHGWQFRKVTIPMDQQNRLGGTNKGQK
IGDTELSVLGHNFTIGSWVGDYSGKFLLSINNLTRDRFLSFLPDGKNYLPLVMFISFVMR
SQFAWELRLGLAENQVSGMVLGAKENNHLGWTSFLGEPEKKPFVTISVME
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacagataggtcaacactcgttgatgtaatcactgagcagggccttgccaca
ccattggcattggacatctcacagtacaacttttaccagttggttgagctgcttaaccag
cttgcgatagcgtgggaaaaaaccggagaaacagatcgtcccgatctggagtctgtccgt
ttccgttccagtgccagactggcattcccgactcgtgatgtcatctcactcgcacagtcc
aagcggggatacttcgaactggaagtttcctttatgggattgcacggtagccagtctccg
atgccgggttactatctggattcactggcatgggaagacgctcagggagaaaaccgcctg
acggattttctcaacctttttaaccatcgcttaattacactcctgcatcagatctggcgg
aaataccgctattacatttacttcaagaaaggcggggaagatagcttttcccagcgcatg
ttctcgctcgtcggtctgggcagtgatatcaaccgccggatgctgaacattaatcacagc
aaaatgttggcctatgccggattgctggcaagccccgggcgttcaccggaagtgatatgc
agccttgtttcccactgttttgatttgcaggacgtgactttacacggttggcaattcaga
aaggtcacgatcccgatggatcagcaaaaccgtctgggtggaaccaataaggggcagaaa
attggtgacacggagctatctgtgttgggacacaacttcaccatcggctcatgggttggt
gattacagcgggaaattcctgctgagcatcaacaatttgacccgtgatcggtttctgtca
tttctgcccgacggcaagaactatctccctctggtgatgttcatctctttcgtcatgcgc
agccagttcgcatgggaactgcgccttggcctggctgaaaatcaggtcagcggcatggta
ttgggggcgaaggagaataaccatctggggtggaccagttttctcggcgaaccggaaaag
aaaccctttgtcacaatttcagttatggaataa

DBGET integrated database retrieval system