KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4553
Entry
XNC1_4553         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein (probable component of the SST VI cluster)
  KO
K11901  type VI secretion system protein ImpB
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_4553
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_4553
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBJ92575
UniProt: D3VFB8
Position
complement(4356311..4356808)
AA seq 165 aa
MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGKTEDTPIEERQTVSIN
KNNFNAVMNEANINLTFNVPNRLDEKSEEDLPVNLEIKSLSDFSPDNVAKKVPELNKLLE
LREALVALKGPLGNIPAFRSRLQSLLDDESVREQLLKELEIVNKK
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagtaagaatagtccaggtagcgtagctccgaaagaaagaattaacattaaatatgtt
cctaataccggtgaccagaccgcagaagttgaattaccgctgaatcttctggttgttggt
gacttgaaaggaaagaccgaagatacgccaattgaagaacggcaaacagtttctattaat
aagaacaatttcaatgcggtcatgaatgaggcgaacatcaacctgactttcaacgtccct
aaccgccttgatgaaaaaagcgaagaagatctgccagttaatctggaaataaaatcactg
agcgatttttcccctgataatgtcgcgaagaaagtccctgaattaaataaacttcttgaa
cttcgtgaagcattagttgcactaaaaggtccattaggaaatatcccggcatttcgttcc
cgcttgcagtcactgttggatgatgaatccgttcgtgagcaactcctgaaagaacttgaa
atcgtcaataaaaaataa

DBGET integrated database retrieval system