KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4554
Entry
XNC1_4554         CDS       T01274                                 

Gene name
hcp
Definition
(GenBank) Hemolysin-coregulated protein Hcp(probable Type VI secreted cytotoxin system component)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xne00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XNC1_4554 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xne02044]
    XNC1_4554 (hcp)
Secretion system [BR:xne02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XNC1_4554 (hcp)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBJ92576
UniProt: D3VFB9
Position
4357739..4358257
AA seq 172 aa
MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFDHIVTVPTDPQSGQPS
GQRAHKPFRFTVALNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFSTKLVDATI
VDIDCKMPHCQDPAKSEFTQLVRVSLSYRKIEWEHTTAGTSGADDWRAPIVA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatttccatcaatggtaaaactcagggcaatattaccgctggc
gcattcacagctgaatccgtaggtaatatctttgttcagggccacgaagacgaaatgctg
gttcaagaatttgaccacattgtcactgttccaactgatccacagtctggacagccttct
ggtcagcgtgcccataagccattccgctttaccgttgctttgaataaagcagttcccctg
ctttacaacgcactggcttccggcgaaatgctgcctactgtagaactgaagtggtaccgt
acttctatcgaaggtaaacaagagcacttcttctcgactaaactggtagatgcaactatc
gttgatatcgactgcaaaatgccacactgccaggacccagcaaaatctgagttcactcag
ttagttcgtgtttctctttcttatcgtaagattgagtgggaacacaccacggcaggtact
tctggtgctgacgactggcgtgcgccaattgttgcttaa

DBGET integrated database retrieval system