KEGG   Xenorhabdus nematophila AN6/1: XNC2_4138Help
Entry
XNC2_4138         CDS       T03752                                 

Gene name
malF
Definition
(GenBank) maltose transport protein (ABC superfamily, membrane)
  KO
K10109  maltose/maltodextrin transport system permease protein
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XNC2_4138 (malF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xnm02000]
    XNC2_4138 (malF)
Transporters [BR:xnm02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    XNC2_4138 (malF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MalF_P2 BPD_transp_1 TM_PBP2_N
Motif
Other DBs
NCBI-ProteinID: CEK25125
UniProt: A0A0R4FR50
Position
I:complement(4127491..4129047)
Genome map
AA seq 518 aa AA seqDB search
MSATLEKTVWWQHPALKWSAIGLCLLCTGYLVVLMYARGEYLFAMLTLVLLGSGIYVFAN
RKAYVWRYTYPGIAGIGLFILFPLICTIAIAFTNYSGTNQLTFERAQTVLMSRQYQAGQP
VNFKLYPVSEKWILALNVPDSSQLLVSAPFSLSGKEETILSLEEQEKDFEGDAATLRSIT
QHRQALGQLVAVLPDGSQLRMSSLRQFSAIHPLYSLHEDRTTLTNKQTGIQYRPNMETGF
YQSINAEGRWDQDTLSPGFTVPIGWKNFLRVIQDEGIQKPFLSIFVWTVIFSLLTVSLTA
ALGMVLACIMQWEALKGRSIYRVLLILPYAVPSFISILIFKGLFNQSFGEINLVLNGLFG
LKPEWFTDPILARTMLIIVNTWLGYPYMMILCMGLLKAIPHDLYEASALDGAGPWQNFTK
ITFPLLIKPLTPLLIASFAFNFNNFVLIQLLTNGRPDHIGTTTPAGYTDLLVSYTYRIAF
EGGGGQDFGLAAAIATLIFLLVGALAIINLKTTRIKFD
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgacattagaaaaaacagtatggtggcagcatcctgccctgaaatggtctgcg
ataggtttgtgtctgctttgtacaggttatctggttgtattgatgtatgcgcggggtgaa
tatctgttcgctatgttgacattggtattgctgggaagcggtatttatgtttttgccaat
cgtaaggcttatgtttggcgctatacctatccgggaattgctggaatagggttatttata
ttgtttccgcttatttgtacgattgccattgcttttaccaactatagcggtactaaccag
ttaacctttgaacgtgctcaaactgtgctaatgagccgccaatatcaggcgggacaacct
gttaatttcaaactttaccccgtatctgaaaaatggattctggcgttaaacgtccctgat
agctctcaattactggtatctgctcctttttcgctctccgggaaggaagaaactattctg
tctctcgaggaacaggaaaaagattttgaaggcgatgccgcgacacttcgctccattact
caacatcgacaagcattaggccaattggtcgcggttcttccagatggaagccaattgaga
atgagttccttgcgtcagttttcggctatacaccccctttattctcttcatgaagataga
acgacgctgacgaataaacaaacgggaatacagtatcgaccaaacatggaaaccgggttc
tatcaatctatcaatgctgaggggagatgggatcaagacacattaagtcctggattcacg
gttcctattggttggaagaattttttgcgggttatacaagatgaaggtattcaaaaacct
tttttgtctatttttgtctggacggtgattttttctctactgacggtgagcctaacggct
gcattaggtatggttctcgcttgtattatgcagtgggaagcgcttaaggggcgatcaatt
taccgtgtactgcttattttgccttatgcggttccttcgtttatctcaattttgattttt
aaggggttatttaatcaaagttttggtgaaataaatctggtattaaatgggttatttgga
cttaaaccggagtggttcacagatccgatacttgctcgaactatgttgattatcgtcaat
acatggttgggctacccctatatgatgattctctgcatggggctactcaaggcgatccct
catgatctctatgaagcatcggcacttgacggagcaggcccgtggcagaacttcaccaaa
attacctttccattattgattaagccattgacaccgttgctgattgccagcttcgctttt
aactttaataactttgttctgattcagttgttaaccaacggcagacctgatcatattggt
acaacgacaccggcgggttataccgatcttttggtaagttatacctaccgtattgcgttt
gaaggcggtggtgggcaagactttggtctggcagcagcaattgcgacactcatattctta
ttagtgggggcattagccatcatcaatttgaaaaccacccgcattaaatttgattga

DBGET integrated database retrieval system