KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO0220Help
Entry
XOO0220           CDS       T00360                                 

Gene name
XOO0220
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00240  Pyrimidine metabolism
xom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    XOO0220 (XOO0220)
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     XOO0220 (XOO0220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: BAE66975
UniProt: Q2P902
Position
complement(240583..241212)
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVVASRIGLRADGR
IFERDTGLQQLVERDIHNDGALHCVLVDEAQFLSRAQVWQLSEVVDRLRVPVLCYGLRTD
FRGELFEGSQFLLAWADELEEIKTICHSGSKATMTVRVDAQGHAVQDGPQVEIGGNERYV
SVSRAEFKKIMRGEGRIDPLQIALPLPVA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttctactattcggcaatgaatgccggcaagaccaccaccttgctg
cagtctgcgcacaactaccgcgagcgcggcatgcgcacgctgatcctgacgcccaagctc
gatcaccgcgccggtagcggcgtggtggcctcgcggatcggcctacgcgcggacgggcgc
attttcgagcgcgataccgggttgcagcagttggtcgagcgcgatatccacaacgacggt
gcattgcactgcgtgctggtggacgaggcgcaattcctcagccgggcgcaggtgtggcag
ctgagcgaggtggtcgaccgcctgcgcgttccggtgctgtgctatggcctgcgcaccgat
tttcgcggtgaactgttcgaaggcagccagtttctgctggcctgggccgacgagctggaa
gagatcaagaccatttgccacagcggcagcaaggcgaccatgacggtgcgtgtggacgcg
caggggcacgcggtgcaggacggcccgcaggtggagatcggcggcaacgagcgctatgtc
tcggtcagccgcgccgagttcaagaaaatcatgcgcggcgagggccgtatcgatccactg
cagatcgccttaccgctgccggttgcctag

DBGET integrated database retrieval system