KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO1823Help
Entry
XOO1823           CDS       T00360                                 

Gene name
XOO1823
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00450  Selenocompound metabolism
xom00970  Aminoacyl-tRNA biosynthesis
xom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XOO1823 (XOO1823)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XOO1823 (XOO1823)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xom01007]
    XOO1823 (XOO1823)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xom03016]
    XOO1823 (XOO1823)
Enzymes [BR:xom01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XOO1823 (XOO1823)
Amino acid related enzymes [BR:xom01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XOO1823 (XOO1823)
Transfer RNA biogenesis [BR:xom03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XOO1823 (XOO1823)
 Prokaryotic type
   Other AARSs
    XOO1823 (XOO1823)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAE68578
UniProt: Q2P4E9
Position
complement(2006105..2008189)
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIASIQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYTKLEAAGHISRR
SVAQFYDPAKGMFLPDRYIKGICPNCGSADQYGDNCEVCGATYAPTELKEPRSVISGATP
ELRDSEHFFFEVGQFDGFLHEWLAGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QMPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGEDFAAHLVDGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFIGKRFDGKLAEALPDAAQYDRF
VAALAPIREAYERNDAASAIRQTMALADEANKYIDDTKPWVIAKQDSADAQLQSVCTQGL
NLFRVLVAALKPILPRTCAEAEAFLSAPMTSWEDVIRPLTSHTIQPYTALFTRIDPKLID
AMTDASKDTLAAPAAPATTSKAAPAKPDTKPAAAANPQSPISNPSFIGMDDFAKLDLRIG
KVLVCECVEGSDKLLRFELDAGELGKRQIFSGIRASYGEPEALVGRSVVFIANLAPRKMR
FGISDGMILSAGFDGGALALLDADSGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcactactgccctgccctacgccaacggcccgctgcatctt
ggccatctggtcggctatatccaggccgatatctgggtgcgcgcgcgccggttgcgcggc
gacaagacctggttcgtctgcgccgacgacacccacggcacgccgatcatgctggccgcc
gagaaggccggggtgaccccggaagccttcatcgccagcatccaggccagccatgagcgc
gatttcgccgcgttcggggtgaccttcgatcattacgattcgaccaattcgccggtcaat
cgcgagcttaccgaagccttctacaccaagctcgaagccgccggccacatcagccggcgc
tcggtggcgcagttctacgaccccgccaagggcatgttcctgccggaccgttacatcaag
ggcatctgccccaactgcggcagcgccgatcaatacggcgacaactgcgaggtctgcggc
gcgacctatgcgcccaccgagttgaaggagcccaggtcggtgatctccggcgccaccccg
gagttgcgcgattcggagcatttcttcttcgaagtggggcagttcgacggtttcctgcac
gaatggctcgctggcgatgtggcgctgcccggcgtcaaggccaagctcaaggagtggctg
gacgccgaaggcggcctgcgcgcctgggacatctcgcgcgacgcgccgtatttcggtttc
cagatgcccggccagccgggcaagtatttctacgtgtggctggatgcgccgatcggctac
ctgtgcagcttcaagacgctgtgcgcgcagatgggcgaggatttcgcagcgcatctggtc
gacggcacgcagaccgaactgcatcacttcatcggcaaggacatcgtcaatttccacggc
ctgttctggccggcggtactgcacggcaccggccatcgcgcgccgacacgcctgcacgtc
aatggctacctgaccgtggacggcgccaagatgtccaagtcgcgcggcaccttcgtgatg
gcgcggaccttcctggatgtcggcctggaaccggaagcgctgcgttactacttcgcggcc
aagtcctccggcggcgtggacgatctggacctcaacctgggcgatttcatcgcgcgggtg
aatgcggacctggtcggcaagttcgtcaacctggccagccgctgcgccggcttcatcggc
aagcgcttcgacggcaagctggccgaggcgctgcccgatgctgcgcagtacgaccgtttc
gtcgccgccctggcgccgatccgcgaggcctacgaacgcaacgatgccgccagcgcgatc
cgccagaccatggcgctggccgacgaggccaacaagtacatcgacgacaccaaaccgtgg
gtgatcgccaagcaggacagtgcagacgcgcagctgcaatcggtgtgcacgcagggcctg
aacctgttccgggttctggtggccgcgctcaagccgatcctgccgcgtacctgtgccgaa
gccgaagcgttcctgtcggcgccgatgaccagttgggaggatgtgatccgcccgctgacc
tcgcacacgatccagccctacaccgccctgttcacccgtatcgaccccaaactgatcgac
gccatgaccgacgcttccaaggacaccctcgccgcacctgcagctccggctaccacctcc
aaagctgcaccggccaagcctgacacaaagcccgctgcagctgcgaatccccaatcccca
atctccaatcccagcttcatcggcatggatgacttcgccaagctcgatctgcgcatcggc
aaggtgctggtctgcgaatgcgtggaaggctcggacaagctgctgcgcttcgaactggac
gccggcgagctgggcaagcggcagatcttctcgggcatccgcgccagctacggcgagccg
gaagcgctggtcggccgcagcgtggtgttcatcgccaacctggctccgcgcaaaatgcgc
ttcggcatcagcgacggcatgattctatcggccggcttcgacggcggcgccctggcgctg
ctggatgccgacagcggcgcgcagccgggcatgccggttcggtga

DBGET integrated database retrieval system