KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3539Help
Entry
XOO3539           CDS       T00360                                 

Gene name
XOO3539
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Brite
KEGG Orthology (KO) [BR:xom00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XOO3539 (XOO3539)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: BAE70294
UniProt: Q2NZI3
Position
4001909..4002292
Genome map
AA seq 127 aa AA seqDB search
MHDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLIARHWQITDGNGR
TEQVDGEGVVGEQPRLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatgatccgcgctatcgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgagggccgctatgccttcgcctacagcatccgcatccagaatgcg
ggcgccgtgcctgcgcggttgatcgcgcgccattggcagatcaccgatggcaacggacgc
accgagcaggtggatggcgaaggcgtggtcggcgagcagccgaggctgcgcccgggcgag
gcgttccattacacctccggcgtgctgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgacggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtacccaggacgctgcactga

DBGET integrated database retrieval system