KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3858Help
Entry
XOO3858           CDS       T00360                                 

Gene name
XOO3858
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00071  Fatty acid degradation
xom00072  Synthesis and degradation of ketone bodies
xom00280  Valine, leucine and isoleucine degradation
xom00310  Lysine degradation
xom00362  Benzoate degradation
xom00380  Tryptophan metabolism
xom00620  Pyruvate metabolism
xom00630  Glyoxylate and dicarboxylate metabolism
xom00640  Propanoate metabolism
xom00650  Butanoate metabolism
xom00900  Terpenoid backbone biosynthesis
xom01100  Metabolic pathways
xom01110  Biosynthesis of secondary metabolites
xom01120  Microbial metabolism in diverse environments
xom01130  Biosynthesis of antibiotics
xom01200  Carbon metabolism
xom01212  Fatty acid metabolism
xom02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOO3858 (XOO3858)
   00630 Glyoxylate and dicarboxylate metabolism
    XOO3858 (XOO3858)
   00640 Propanoate metabolism
    XOO3858 (XOO3858)
   00650 Butanoate metabolism
    XOO3858 (XOO3858)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XOO3858 (XOO3858)
   00072 Synthesis and degradation of ketone bodies
    XOO3858 (XOO3858)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO3858 (XOO3858)
   00310 Lysine degradation
    XOO3858 (XOO3858)
   00380 Tryptophan metabolism
    XOO3858 (XOO3858)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XOO3858 (XOO3858)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XOO3858 (XOO3858)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XOO3858 (XOO3858)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xom04147]
    XOO3858 (XOO3858)
Enzymes [BR:xom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XOO3858 (XOO3858)
Exosome [BR:xom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOO3858 (XOO3858)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE70613
Position
4361465..4362760
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNMGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREATLSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRVKATGDKLKTLLRGFKLGELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTALTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGQGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcacgtcccgtcgccattttgggcggcgttcgtatc
ccgttttgccgtcagaacaccgcatacgcggatgtaggcaacatgggtatgtcggtgcgc
acgctgggcgcgctggtcgagcgcttcgggctgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactcctcggactggaatctggcccgcgaggcgacgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgattaccatcgccaacaagatcgcgctggggcagatcgattcgggcatcggc
ggcggttcggacaccacctccgaagtgccgatcgtctacggcaagaaactgcgcgcgcgg
ctgttggccgccaatcgtgtcaaggccaccggcgacaagctcaagacgctgttgcgcggc
ttcaagctgggcgagctcaaacccgaattccccggcgtggccgaaccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggccgctgcgtatgagcgcggtttcttc
gatgcgctgatcgccccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaactcgccacgctgcgtcccgccttcgacaagacctccggccgcggcacg
ctcaccgcggccaattccactgcgctgaccgatggcgccgccgcggtgctgctgtccagc
gaagcctgggcgctggcgcatggtcacacaccgatggcctatctgcgcgatgcacaagtc
gcggcagtcgatttcgtgcatggccaaggcctgctgatggcgccgaccatcgccgtgccg
caaatgctggcacgacagggcctgaccctgcaggacttcgacatctacgaaatccacgaa
gccttcgctgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggattactgccgc
aatcgcctgggcctggatgcgccgctgggccgcatcgaccccgacaagatcaacccgctg
ggttcctcgctagccaccggccacccgttcgcggccactggtgcgcgtgtggtggccacg
gccgccaagcagctggaagaacgcggcggcggccgtgcattgatttcgatctgcaccgcc
ggcggcatgggtgtggtggcgattgtcgagcgctga

DBGET integrated database retrieval system