KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO4142Help
Entry
XOO4142           CDS       T00360                                 

Gene name
XOO4142
Definition
(GenBank) glycyl-tRNA synthetase beta chain
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xom00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XOO4142 (XOO4142)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xom01007]
    XOO4142 (XOO4142)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xom03016]
    XOO4142 (XOO4142)
Enzymes [BR:xom01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     XOO4142 (XOO4142)
Amino acid related enzymes [BR:xom01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   XOO4142 (XOO4142)
Transfer RNA biogenesis [BR:xom03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    XOO4142 (XOO4142)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: BAE70897
Position
complement(4671051..4673288)
Genome map
AA seq 745 aa AA seqDB search
MSEQLPLLIELGTEELPVKALPDLAQAFFDGVLSGLEKRGIAVTRGAAKPLSTPRRLAVL
LPGVATEQPEQRSEVLGPYLNIALDAEGQPTKALAGFAAKAGIDWTALERTSDAKGERFV
HRAVTPGARTAELLPEILREAIAAMPIPKPMRWGGHEYAFARPVQWLVLLFGNEVIPAEL
LGVRGDRITRGHRFMHEGAVSLAVPGDYVEALRAAHVLVDPDARRTRIVEEVEASAKQAG
GSARISDDNLEQVVNLVEWPSAVLCSFERDFLAVPQEALIETMEINQKFFPVLDDGGTLT
EQFIGIANIQSKDVAEVAKGYERVIRPRFADAKFFFDEDLKQGLQAMGDGLASVTYQAKL
GTVADKVARVAALAEVIAPQVGADPLQARRAAELAKNDLQSRMVNEFPELQGIAGRHYAK
AAGEPSEIALAIDQAYQPRFAGDDIALSPLGKVLAIAERLDTLAGGFAAGLKPTGNKDPF
ALRRNALGLARTVIESGFDLSLTELLKKAVGLVNSALAWSQASKQQTAVEAAKVQGVHVA
ERQSGGLWVPNVEATSAEILDFILDRLRGYYADKGVPATHFNAVAALFSGTSEAVTAPTG
VGAHPGATHGSLYDFDRRIDAIGIFATLPEAQALAAANKRIRNILRKVEGEIPGDIDTAL
LREPAEEALAEAVEAAIGATGDALHRHDYVAVLARLARLRPQVDAFFDGVMVNAEDPQLR
ANRLALLKKLGDRLGSVAAIEHLSS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaacttcccctgctgatcgaactgggcaccgaagagctgccggtcaaggcg
ctgccggatctggcgcaggcgtttttcgatggtgtgctcagcggcctggaaaagcgcggc
attgccgtcacccgtggcgctgccaaaccgctgtccaccccgcgtcgtctggcggtgctg
ctgccgggcgtggccaccgagcagccggagcagcgctccgaagtgctgggaccgtatctc
aacatcgccctcgacgccgaaggccaaccgaccaaggcattggcgggtttcgcggccaag
gccggcatcgactggaccgcgctggagcgcaccagcgacgccaagggcgagcgtttcgtg
caccgcgcggtgaccccgggcgcgcgtaccgccgagctgttgccggagatcctgcgcgag
gccatcgccgcgatgccgattcccaagccgatgcgctggggtgggcacgaatacgccttc
gcacggccggtgcagtggctggtgctgctgttcggcaacgaggtgatcccggccgaattg
ctgggcgtgcgtggcgatcgcatcacgcgcggccaccgcttcatgcatgagggcgcggtc
tcgctggcggtgccgggcgactatgtcgaagccttgcgtgcggcgcatgtactggtggat
cccgatgcgcgccgcacccgcatcgtcgaagaagtggaagcgtccgccaagcaggccggc
ggcagcgcgcgcatcagcgacgacaacctggagcaggtggtcaacctggtcgaatggccg
tcggcggtgctgtgcagtttcgaacgcgatttcctggcggtgccgcaggaagcgttgatc
gaaaccatggagatcaaccagaaattcttcccggtgctggacgacggcggcaccttgacc
gagcagttcatcggcatcgccaacatccaatccaaggacgtggccgaagtcgccaagggc
tacgagcgcgtcatccgtccgcgctttgccgacgccaagttcttcttcgacgaagacctc
aagcagggtctgcaggcgatgggcgatggtctggccagcgtcacctatcaggccaagctg
ggcacggtggccgacaaggtcgcacgcgtggcagcgctggcggaagtcatcgcgccgcag
gtgggcgccgacccgctgcaggcacgccgcgctgcagagttggccaagaacgacctgcaa
tcgcgcatggtcaacgaattcccggaattgcagggcattgccggccgccattacgccaag
gcagccggtgagcccagcgagattgcgctggccatcgaccaggcctaccaaccacgcttt
gccggcgacgacatcgcactgtcgccgctgggcaaggtgctggcgattgccgaacgcctg
gataccttggccggtggatttgcggccgggttgaagccgaccggtaacaaggatccgttt
gcgctgcggcgcaatgcgttggggttggcgcggacggtgattgagagtgggtttgatctg
tccctaactgaattgctcaagaaagcagtcggtttggttaattccgctttggcttggtcg
caagctagcaaacaacagacagcggttgaggctgccaaggtgcaaggtgtccatgtcgca
gagcgtcagagcggcggattatgggtgccaaacgtagaggcaacttcagcagaaatcctc
gacttcatcctcgaccgcctacgcggctattacgccgacaagggcgtaccggctacgcat
ttcaacgcggtcgccgcattgttctccggcacgtccgaagccgtgacggcaccgaccggc
gtaggagcgcacccgggcgcgacccacggctccctttacgacttcgaccgccgcatcgat
gccatcggcatcttcgccacgttgcccgaagcccaagcgttggccgcggccaacaagcgc
atccgcaatatcctgcgcaaggtggaaggcgagattcccggcgacatcgacactgcgctg
ttgcgcgaaccggccgaagaagccctggccgaagcggtggaagccgccatcggcgctacc
ggcgatgccttgcatcgccacgactacgttgccgtgctcgcacgcttggcgcgcctgcgc
ccacaagtggatgcgttcttcgacggcgtgatggtcaatgccgaagacccgcagctgcgt
gccaaccgccttgccctgctgaagaagctcggcgaccgcctcggcagcgtcgccgccatc
gagcacttgtccagctga

DBGET integrated database retrieval system