KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO4272Help
Entry
XOO4272           CDS       T00360                                 

Gene name
XOO4272
Definition
(GenBank) RTS beta protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00051  Fructose and mannose metabolism
xom01100  Metabolic pathways
xom01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XOO4272 (XOO4272)
Enzymes [BR:xom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     XOO4272 (XOO4272)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N PAS_12 DUF5526
Motif
Other DBs
NCBI-ProteinID: BAE71027
Position
complement(4829551..4830870)
Genome map
AA seq 439 aa AA seqDB search
MSTIVALDTHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAADDLAGYGLVFTIGRGN
DVQTAAVAALAEHVLGLRVEDVIADLGAFARRLTNDSQLRWLGPEKGVMHMAIGAVINAA
WDLAARAANKPLWRFIAELTPEQLVDTIDLRYLSDALTRDEALAILRDAQPQREQRIAQL
IEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVGANVQDDIRRCRLAREAIG
PDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGITPVPVSTG
EHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLAAKFNVRVFPHAGGVGLCEL
VQHLAMADFVAITGQMEDRAIEFVDHLHQHFLDPVRIRHGRYLAPDVPGFSAEMHAASIA
EFSYPNGRFWVEDLAAAKA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgtcgccctcgatacccacgacgtccgcttccccacctcgcgcgagctg
gatgggtcggacgcgatgaatcccgatcccgattactcggcggcctacgtcgtgctgcgc
accgatgctgccgatgacctggccggttacggcctggtgttcaccatcggccgcggcaac
gacgtgcagaccgcagcggtggcggcgctggccgagcatgtgctcggcctgcgggtggaa
gacgtcatcgccgatctgggcgcgttcgcgcgtcggctcaccaacgattcgcagctgcgc
tggctcggcccggaaaagggcgtcatgcacatggccatcggcgcggtgatcaacgctgcg
tgggacctggctgcgcgcgccgcgaacaagccgctgtggcgcttcattgccgaactcacg
cccgagcagttggtcgacaccatcgacttgcgctatctcagcgacgcgctcacccgcgac
gaagcgctggccatcctgcgcgatgcgcaaccgcagcgtgagcaacgcatcgcgcagttg
atcgagcaaggctacccggcctacaccacctcgcccggctggctcggctactcggacgag
aagctggtgcgactggccaaggaagcggtggccgacggcttccgcaccatcaagctcaag
gttggcgccaacgtgcaggacgacatccgccgttgccgcctggcgcgcgaagccatcggc
ccggatatcgcgatggcggtcgatgccaatcagcgctgggacgtgggcccggcgatcgac
tggatgcgccagctggccgaattcgacatcgcctggatcgaagaacccaccagcccggac
gatgtgctcggccatgccgccatccgccagggcatcaccccggtgccggtctccaccggc
gagcacacccagaaccgggtggtgttcaagcaactgttgcaggccggcgcggtggacctg
atccagatcgatgccgcgcgcgtgggcggggtcaacgagaaccttgccatcctgctgctg
gccgccaagttcaacgtgcgcgtgttcccgcatgccggcggcgtgggcctgtgcgaactg
gtgcagcacctggccatggccgacttcgtcgccatcaccggccagatggaagaccgcgcc
atcgaattcgtcgatcatctgcaccagcacttcctggacccggtgcgcatccggcacggc
cgctacctggcgccggacgtgccgggtttctccgcggaaatgcatgccgcctcgattgcg
gagttcagctatcccaacggacgcttctgggtcgaagacctggcggctgcaaaagcgtaa

DBGET integrated database retrieval system