KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0928Help
Entry
XOO0928           CDS       T00235                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOO0928 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 CMAS Methyltransf_23 MTS PrmA Methyltransf_12 NodS GCD14 Methyltransf_24 Methyltransf_18 Methyltr_RsmB-F RMMBL
Motif
Other DBs
NCBI-ProteinID: AAW74182
UniProt: Q5H4D9
Position
complement(960079..960750)
Genome map
AA seq 223 aa AA seqDB search
MDNRTMTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIP
LSAGYKMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFATACLATLAREVVSLEIDPALAA
AARANLDRTGLGSNVRIETADVFCWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVV
HGHEPVMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggataaccgcaccatgacgatcgatttcacccaggcccgcgaaaagatggttgagcag
cagatccggccgtgggacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccg
cgcgaagccttcgtgccggaggcctacaagacgctggcctatgtcgacgtggaaattccg
ctgtcggccggttacaagatgatgaagccggtcgtcgaaggccgcatgttgcaggcgctg
gatctgcagccgggcgaagacgtgctggaagtgggcactggcagcggctttgccaccgcc
tgcctggccacgctcgcgcgcgaagtcgtcagcctggagatcgacccggcgctggcggcc
gccgcacgcgccaatctggaccgtaccggcctgggtagcaatgtccgtatcgaaaccgcc
gacgtattctgctggcagagcgaacgtcgcttcgatgccatctgcgtgaccggcgcggtc
gataccctgcccgtgcagtggctgcagtggttgcgcccgaacggccggctgtttgtcgtg
cacggtcacgaaccggtgatggaagcggtcctggtccggggcgacgtcaacgccccgcgc
atcgaatcgttgttcgaaaccgacctcgcctatctccagggcgccgcaccgacgccccga
ttccagttctga

DBGET integrated database retrieval system