KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1785Help
Entry
XOO1785           CDS       T00235                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00010  Glycolysis / Gluconeogenesis
xoo00052  Galactose metabolism
xoo00500  Starch and sucrose metabolism
xoo00520  Amino sugar and nucleotide sugar metabolism
xoo00521  Streptomycin biosynthesis
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
xoo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO1785 (glk)
   00052 Galactose metabolism
    XOO1785 (glk)
   00500 Starch and sucrose metabolism
    XOO1785 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XOO1785 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO1785 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XOO1785 (glk)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XOO1785 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAW75039
UniProt: Q5H1Y2
Position
1878412..1879512
Genome map
AA seq 366 aa AA seqDB search
MLTTLSTPFAVRRTTGDDARRRHRSGECVSASSPMEAVAFPRPETFVAADVGGTHVRLAL
VCESNDAGKPVTVLDYRKYRCAEYPGLAEIMAAFFAEVGCAPVRRGVIASAGYALDDGSV
ITANLPWVLAPEQIRRQLGMQALYLVNDFEAVAYAANYMSGNQVMQLSGPAQGAAGPALV
LGPGTGLGAALWIPHGAHPVVLPTEAGHAALAPASDLEVELLQELRRTRTHVCTETLLSG
PGLLNLYTALGALRGDAVLHANPAEITAAALAGNDALAHDALQAFCGFMGSVVGDLMLLY
GVRSGVYLAGGFLPQIAGFIAESDFVARLLDKGALRPALEQVPVSIVEHGQLGVIGAASW
FLLHGR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgctgacaacgttgtctaccccgtttgccgttcgtcggacaacgggcgacgacgccagg
cgtcgccacagatcaggagaatgcgtgagcgcaagcagtccaatggaagcggtggccttt
ccgcgccccgaaaccttcgttgccgccgatgtgggcgggacgcacgtgcgcctggcgctg
gtgtgcgaaagcaatgacgcaggcaagccagtcactgtgctggactatcgcaagtaccgt
tgcgccgagtatccgggtcttgccgagatcatggccgccttcttcgcggaggtgggctgc
gcgccggtgcgccgtggcgtgatcgccagcgccggttacgcattggacgacggcagcgtg
atcaccgccaatctgccctgggtgctggcccccgaacagattcgccgccagctgggcatg
caggccttgtatctggtcaacgatttcgaagcggtcgcctacgcggccaattacatgagc
ggcaaccaggtcatgcagttgtcgggccccgcgcaaggcgccgcgggcccggcgttggtg
ctcggtccggggacgggcctgggtgcggcgctgtggattccccacggtgcccacccggta
gtgctgccgaccgaggctggccacgcggccctggcacctgccagcgatctggaagtggaa
ctgctgcaggaactgcggcgcacgcgtacccacgtgtgcaccgagacgctgttgtccggc
ccgggcctgttgaatctgtacaccgcgctgggcgcactgcgcggcgacgctgtgctgcat
gccaaccccgccgagatcaccgctgccgcattggctggcaacgatgcactggcgcacgat
gccttgcaggcgttctgcgggttcatgggcagcgtggtcggcgacctgatgctgctgtat
ggcgtgcgtagcggtgtctatctggctggcggcttcctgccgcagatcgccggctttatc
gctgaaagcgatttcgtcgcacgcctgctcgacaagggcgcgttgcgtccggcgctggaa
caggtgccggtgagcatcgtcgagcacggccagctcggcgtcatcggtgcggccagctgg
tttctgctgcacggccgctga

DBGET integrated database retrieval system