KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1881Help
Entry
XOO1881           CDS       T00235                                 

Gene name
atoB
Definition
(GenBank) acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00071  Fatty acid degradation
xoo00072  Synthesis and degradation of ketone bodies
xoo00280  Valine, leucine and isoleucine degradation
xoo00310  Lysine degradation
xoo00362  Benzoate degradation
xoo00380  Tryptophan metabolism
xoo00620  Pyruvate metabolism
xoo00630  Glyoxylate and dicarboxylate metabolism
xoo00640  Propanoate metabolism
xoo00650  Butanoate metabolism
xoo00900  Terpenoid backbone biosynthesis
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
xoo01200  Carbon metabolism
xoo01212  Fatty acid metabolism
xoo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOO1881 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    XOO1881 (atoB)
   00640 Propanoate metabolism
    XOO1881 (atoB)
   00650 Butanoate metabolism
    XOO1881 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XOO1881 (atoB)
   00072 Synthesis and degradation of ketone bodies
    XOO1881 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO1881 (atoB)
   00310 Lysine degradation
    XOO1881 (atoB)
   00380 Tryptophan metabolism
    XOO1881 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XOO1881 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XOO1881 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XOO1881 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xoo04147]
    XOO1881 (atoB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XOO1881 (atoB)
Exosome [BR:xoo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOO1881 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAW75135
UniProt: Q5H1N6
Position
complement(1984213..1985388)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNGVPAPTLAAAAIQGALAQSGIAPADVSEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTVNKVCGSGMKAIMFGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFADEIVPVTVATRKGKVVVDSDEQPGKSDVAKILTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDARRRGVTPLARIVGHVTHSQEPEWFTTAPVAAIQSLVG
KIGWQLDEVDLFEINEAFAVVAMTPIKQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGTRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgcactgccatcggctcgttcctcggccaa
ttcaacggagtgccggcaccgacactcgccgccgctgccatccagggcgcgctcgcgcag
tcgggcatcgcgccggccgatgtctccgaagtcatcgtcggctgcgtgctgccggccaat
ctcggccaggcaccggcgcgtcaggccgcgatcgcggcaggcattcccacctcgaccggc
gctaccaccgtcaacaaggtctgcggctcgggcatgaaagcgatcatgttcggacacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gcgccgcatctgctgcccaactcgcgcaccggcaatcgctacggcaatttccaggcggtc
gatcacatggcctgggacggtctgaccaacccgtacgatggccaggccatgggcgtattc
ggcgaggccactgccgaaaaattcggcttcagccgcgccgatcaggatgcattcgccatc
gcctcggtggaacgcgcacaggccgcgcagcgcagcggcgcatttgccgacgaaatcgtt
ccggtaacggtggccacgcgcaagggcaaggtcgtcgtcgacagcgatgagcagccgggc
aaatccgacgtggccaagattctgaccttgaagccggcgttcaagaaagacggaagcgtg
accgcggcaagctcctccagtatttccgatggcgcggcgatcacggtgctgatgagcgcg
gacgacgcgcgacgccgcggcgtgacgccgctggcgcgcatcgtcggccatgtcacccat
tctcaggaacccgaatggttcaccaccgcaccggtcgctgcgatccaatcgctggttggc
aagatcggctggcaattggacgaggtcgatctattcgaaatcaacgaagcattcgccgtc
gtggcgatgacgccgatcaagcaactcggcatcgcgcacgacaaggtcaacgtacatggg
ggcgcctgtgcattgggtcatccgatcggtgcatcgggcgcgcgcttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcacgcgcggaatcgcgacgctgtgcatcggtggc
ggcgaagcgactgccatcgccatcgaattgatttaa

DBGET integrated database retrieval system