KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1970Help
Entry
XOO1970           CDS       T00235                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00900  Terpenoid backbone biosynthesis
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XOO1970 (dxr)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XOO1970 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AAW75224
UniProt: Q5H1E7
Position
complement(2072244..2073434)
Genome map
AA seq 396 aa AA seqDB search
MAGSSLRQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHQPAHAL
IADAALYPALRDGLRALGLATQAHAGAEALDALAGSDACDTVVAAIVGAAGLPSTLAAAR
AGKRLLLANKESLVLAGELLTRTATAAGAEIIPIDSEHSAIFQCLRSCDAGRGVRRVILT
ASGGPFRGRDRAGLAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGE
QIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLSQGR
LDFEAPDTAAFPCLRLAWDALRAGGTAPAILNAANEVAVSAFLQGQVGFLAIPALVEHAL
TTLPRHNADTLDTLLFADAQARQITERALAHHALHA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctggttcttctctccgtcaggtcgccgtcttcggcgccaccggctcgatcggcgca
tcggcgctggacgtgatcgcgcgccaccccgagcggctgcgcgccagcgtgctgtcggcc
ggcagcaaggtcgaggacctgctggcgctgtgcgccgcgcaccagcctgcgcatgcgctg
atcgccgatgcagcgctgtacccggcgctacgcgatggcctgcgcgcgctcgggctggcg
acccaggcgcatgctggcgccgaggcgctggacgcactggccggcagcgacgcgtgcgac
accgtggtggcggccatcgttggtgcggccgggctgccgtctacgctggccgcggcgcgc
gctggaaagcgtctgttgctggccaacaaggaatcgctggtgctggccggcgagttgctg
acccgcaccgcaaccgccgccggcgctgaaatcattccgatcgacagcgaacacagcgcc
atcttccagtgcctgcgctcctgcgacgctggccgcggcgtgcgccgggtcatcctgact
gcctccggtggcccgttccgtggccgggaccgcgcagggcttgcggcagtcacgcctgcg
caggcggtggcgcatcctaagtggtcgatggggccgaagatctcggtggattcggccacc
ctgatgaacaagggcctggaagtgatcgaggcgcatcacctgttcggcctgccgggcgag
cagatcgatgtgttggtgcacccgcaaagcctggtgcattcgctggtcgaattcgtcgac
ggctccaccctggcccagcttggcctgccggacatgcgcaccactctggcggtgggcttg
gcctggccggagcgggtcgaatccggggttggcgggctggacctgctcagccagggccgg
ctggatttcgaggctccggacaccgccgcattcccgtgcctgcgcctggcctgggacgca
ttacgggccggtggcaccgcaccggcgatcctgaacgcggccaacgaagtcgctgtttca
gcgtttcttcagggccaggtgggtttcctagcgatccctgcgttggtcgaacacgcactg
acaacgctcccgcggcacaatgccgacaccctcgacaccctgctttttgccgatgcgcaa
gcccggcaaatcactgaacgcgccctcgcccaccacgcccttcatgcctga

DBGET integrated database retrieval system