KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2666Help
Entry
XOO2666           CDS       T00235                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00330  Arginine and proline metabolism
xoo00332  Carbapenem biosynthesis
xoo01100  Metabolic pathways
xoo01130  Biosynthesis of antibiotics
xoo01230  Biosynthesis of amino acids
Module
xoo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XOO2666 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XOO2666 (proB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XOO2666 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAW75920
UniProt: Q5GZF1
Position
complement(2828764..2829951)
Genome map
AA seq 395 aa AA seqDB search
MSGTRTEYAAAMSTPASTSSPFAEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQF
VSANLAAGRELVIVSSGAVAAGRAILPKAVDVGAPIAARQALAALGQAQLIALWQRFFER
PVAQVLLTHDDLRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIV
AALVDADALFIATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRT
KLEAAAKAGAAGIETYLFNGRSGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEA
GAILVDAGAAMALSDKGASLLPGGVVGAEGDFRRGDMVEIRLRDDEGERCLARGVSQYSA
VDIRRIARRHSREIENVLGYSYGENVVHRDDLVLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaacacgcactgagtacgccgctgccatgagcacaccagccagcacgtcgtcg
ccctttgccgagcaggcactgccgccgtggcggcgtgccgtgctcaaggtcggcagtagc
ctgcttgctgccgatggcggtggcctgtcgccgcgtttcgcattggggctggcgcagttc
gtctctgctaacctggcggcggggcgcgagctggtgatcgtgtcgtcgggcgcagtggcg
gcgggccgcgccatcctgccgaaagcggtggatgtcggcgcgccgatcgcggcacgtcaa
gcgctggctgcgctcggccaggcgcagttgatcgcgctgtggcagcgctttttcgagcgc
ccggtggcgcaggtgctgctcacccatgacgatctgcgcaaccgtcgccgctatctcaat
gcacgcgccacattgggcgagttgttgcggttgggcgcgttgccggtgatcaacgaaaac
gacaccgtttcggtggatgagttgaagctgggcgataacgacaacctggccgcaatcgtg
gccgccttggtcgatgccgatgccttgttcatcgccactgatatcgacggcttgtatagc
gccgacccacgcagtaaccccttggcgcggccgctcgacgatgtgcccgagctcacgccg
gaggtgctggcgatggctggcggcagcggcagcaatgtaggcaccggcggcatgcgcacc
aaattggaagccgctgcaaaggcgggtgcggccggcatcgaaacctatctgttcaacggc
cgcagtggcgaggtggtgcgcgccctggcgcaggaccgcctgcgtggcacgcgcatccat
gccgcacgcacgcgcattgccgcacgcaagtactggctacggcacgcgccggtggaagcg
ggcgcgattctggtcgatgccggcgcagcaatggcgctgagcgacaagggcgcctcgctg
ttgccgggcggtgtggtcggtgccgagggcgatttccgccgcggcgacatggtggagatt
cgcctgcgtgatgacgagggcgaacgttgtctggcacgcggcgtcagccagtattcggca
gtggatatccgtcgcatcgcacgccgccactcgcgcgaaatcgagaacgtactcggttac
agctatggcgagaacgtggtgcatcgcgatgatttggtgttgttgtag

DBGET integrated database retrieval system