KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3046Help
Entry
XOO3046           CDS       T00235                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3046
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AAW76300
UniProt: Q5GYC1
Position
complement(3279317..3280357)
Genome map
AA seq 346 aa AA seqDB search
MHARTQRGRSMASPSRQSADPVALFARLDAQPQAFELFEALRWLECAHPAQPRLGQAARP
LEEPVRLGQRASLEFPPRDIDSVHAGVDGRPPTLRTLSLGLFGPHGALPLHLTEHAIERE
SAGDPTFAAFADMFHHRMIALWYRAWADARPTVQMDRVGDDRFGARLDALTGVDQPALRD
RDAMPVAARRHFAGRFIAQARNAEGLRAVLTGLFDVPVQVQEFVANWLTLPEEGRLRMGR
AAARIGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGQALDVLTAAVRGYIGDEQA
WDLQLVLAREDVPLPVLGQGQRIGLSLWLGHYRRTLDADQLVLTSP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccgaacgcaacgaggtcgctcgatggccagcccatctcggcaatcggccgat
cctgtagcgctgttcgcgcggctggatgcgcaaccgcaggccttcgagctattcgaagcg
ctgcggtggctggagtgcgcgcatccggcgcaaccgcgtctgggccaggcagcacggccg
ttggaagagcctgtgcgtttgggccagcgcgcctcgctggaatttcctccgcgcgacatc
gacagcgtgcacgctggcgttgacggtcgcccgccgaccctgcgcacgctgtcgctgggc
ttgttcggcccgcatggtgcgctgccgttgcacctgaccgagcacgccatcgaacgtgaa
agcgctggcgatcccacctttgcggcctttgccgacatgtttcaccatcgcatgattgcg
ctgtggtatcgcgcctgggccgatgcgcgacccaccgtgcagatggatcgcgtgggcgat
gaccgcttcggcgcgcggctggatgcgttaaccggtgtggaccaacctgcgttacgtgat
cgcgatgcgatgccggtggctgcacgccggcacttcgccggtcgcttcattgcccaggcg
cgcaatgcggaaggcttgcgtgctgtgctgaccggcctgttcgacgtcccggtgcaggtg
caggaattcgttgccaactggttgacgctgcccgaggaagggcgactgcggatgggacgt
gctgctgcgcgtatcgggcgtgacgccacgcttggcgcatcggcgcgcaacgcgcagcat
cgcttccgcctgcggatcggccccttggagatcgcccgctaccgcgagttcctgccgggc
ggccaggccctggacgtactgaccgccgcagtacgcggctacatcggcgacgagcaggcc
tgggacttacaactcgtgctggcgcgcgaagacgtcccgttgccagtcctggggcagggc
cagcgcatcggcctgtcgctgtggctcggccactatcgccgcacgctcgatgccgaccag
ctcgtgcttacgtcgccctga

DBGET integrated database retrieval system