KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3048
Entry
XOO3048           CDS       T00235                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3048
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3048
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AAW76302
UniProt: Q5GYB9
Position
complement(3282172..3282675)
AA seq 167 aa
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHE
DALQAYPHVASSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKV
DIGRMDRMSLSFVIDSELWAQPLPLALYLRTDLDLETGRFSLSSAGH
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccgaactgacccaacaagagcgtttgcagccatcgctgctggaccgattgatcgac
gaccgccgacacgaaccggcggaaagccgcgacgcgcgggcgatcagtccagccaagctg
cgcgactgcgtcatgcgcgacctggcctggctgctcaattgcacgcgccactggcatgag
gatgcgttgcaggcgtatccgcacgtcgccagctcggtactcaattacggcattcccgac
ctggccggcgcacggctggcggggctggacgtgatcgcactgcagaaccgcattcgtgag
gcgattgtggcgttcgagccgcgcctggctgcggccagcctgcaggtcaccgcgaaagtg
gatatcgggcgcatggaccgcatgtcgctgtccttcgtcatcgattccgaattgtgggca
cagccgctgccgctggcgctgtatctgcgcaccgatctcgatctggaaaccggtcgtttc
agtctgtcttcggcaggccactga

DBGET integrated database retrieval system