KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3466
Entry
XOO3466           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: Phage_GPD
Other DBs
NCBI-ProteinID: AAW76720
UniProt: Q5GX51
Position
3708207..3708962
AA seq 251 aa
MDPVATVLSALAAPHQQERLLRLHTPLGPDVLVAETLNGRESVDGGGFRFDVGALSANAG
LPLDALLGQPVLLELLTAESHTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQR
VDSYVFQDMSVVEIAESVFADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAQDA
DDLFFGKTLLHVQSPRGRELDSQLRCYSNLGGRRGRQRHRPPPAAVAAAAVNSTRGRALP
RHRHRAARRRS
NT seq 756 nt   +upstreamnt  +downstreamnt
atggacccagtcgctaccgttctttccgcattggccgccccgcaccagcaagaacgcctg
ctacggttgcataccccgcttggccccgacgtgctggttgccgagaccctgaacggccgc
gagtcggtcgacggcggcggcttccgcttcgacgtgggcgcactatcggccaacgccggc
ctgcccctggacgcgctgctcggccagccggtgctgctggaactgctcaccgccgaatcg
cacaccgcgctgcgcccgttccacggccatgtcaccgcgttcgaacgcctcggcagcaac
gggggcctggcgcgctaccggctgcgggtggagccgtggctggcgctgctggcccagcgt
gtggacagctacgtgttccaggacatgagcgtggtggagatcgccgagagcgtgttcgcc
gactacgccgggcaaggcgcgctggcgccggcgtggcgctgggagctgtccgaccgcagc
acgtacgccaggcgcagcctgaccacgcaatacgaagagacagacttcgcgcaggacgcc
gatgatctgttcttcggaaaaacgcttcttcacgtccaatctcctcggggtagggaattg
gactcccaactgaggtgctactcaaacttggggggacgtcgtgggcggcaacgccaccgg
ccgccaccggcagcagttgctgcagcagccgtgaactcgactcgcgggcgcgcgttgcca
aggcatcggcaccgcgcagctcgccgacgctcttga

DBGET integrated database retrieval system