KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3488Help
Entry
XOO3488           CDS       T00235                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3488
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2345 T6SS_Vgr DUF4178 Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: AAW76742
UniProt: Q5GX29
Position
3742460..3743893
Genome map
AA seq 477 aa AA seqDB search
MPAATPLRALPQDRSRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPTPGGLTD
SASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQL
YNGEVAPPFGGGLDARAGHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTR
LELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVA
QLHGAQRTVQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQPATKPGDG
GRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVS
GQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQA
GQTRITLEGGDITFACPGQFTVKASMHPFLGGESGSAALPPLPDSLKKPDGTAPFSV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggccacgcccttgcgcgcgctgccgcaggaccgctcgcgcatgcccgggccg
cagagcgcgcgcgtggtcggcgtggccgacgcggcgctgagcccgagccgcgaccaccag
gtgcggatccagttcccgtggcagcgcggcgaccagcccaccccgggcgggttgaccgac
agcgccagcaccgcgcccggccacgcgccgggcgaccagcgcgccggcacctgggtgccg
gtggccgagtgggtggccggcccgaactggggcagccacttcctgccgcgcatcggcagc
gaagtgctggtggagttcctgcacggagacatcgatcagccgcgcatcaccggccagttg
tacaacggcgaggtcgccccacccttcggcggcggcctggacgcgcgtgccggccacccc
ggcacgctcagcggcctgcacacccagtcccacgacggcagcggcacccagcaatggctg
ctggacgacacccccggccagctgcgcacgcgcctgcacacctcgctggccgacacccgg
ctggaactgggctacctggtccagcacagcgacaccgcccgcggcgcgctgcgcggccag
ggcttcgaactggcctcccagggctggggcaacgtgcatgccgcgcaaggcctgctgctg
tccagcagcgcccgcggccagggcgcctcgaccgcattggacgtggccgaggcggtggcc
cagttgcacggcgcccaacgcaccgtccaggcgctgcacgccaccctgacccagcaacag
gtgcccggcctggacgcccatcccagcgtgacccggctgcgcgaggccatcgacccgcag
gcgcagggcaagtacaccgctgcggtcggcggccagccggcgaccaagccgggcgacggc
ggccgcgacggccaggcaccggtggaacgcttcgcccaggcgcgcctgctcggcgagtcg
ccggaccacatcgcctggaccaccccggccagcgcggtggcctatgccgggcaggccctg
cagttgaccgtgcagcaggatgcgcagctgagcgccgggcagaccctgtcggcggtgtcc
ggccagcacaccgcgctgttcgcccaacgcgggccgatcaaactcatcgccgccgccggc
ccggtgagcctgcaggcacataccggcgcgctggaactgctggccgaccaggcggtgacc
gtcaccgccaccgacacccgcatcgacgtgctggcgcagcacaagatcgtgctgcaggcc
ggacagacccgcatcaccctggaaggcggcgacatcaccttcgcctgcccggggcagttc
acggtcaaggccagcatgcatccgttcttgggtggggagagcggcagtgccgccctgccg
cctttgcctgacagcttgaagaagcccgatggcactgcacctttctccgtctaa

DBGET integrated database retrieval system