KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3504
Entry
XOO3504           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: Phage_GPD YiaAB UbiA
Other DBs
NCBI-ProteinID: AAW76758
UniProt: Q5GX13
Position
complement(3764610..3765293)
AA seq 227 aa
MIMRTRIANHSSVAFVGALWVGLLLFGVFAAVSVQKSVRDRVDGIGVTAIHHGEAGCSVV
AALSLLTVGLCNATPPLSAKIVEAVFADYAPMASWQWSEETSAFLGQARPRSYCVQYRES
DLDFVQRLLAEEGLGWRLQEAAPSPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATE
AADSVLAIGATRRLGSGRLTVLSEDFKTRQARSAQLPLHGGGRQSLR
NT seq 684 nt   +upstreamnt  +downstreamnt
gtgatcatgcgaacgcgtattgccaaccattcgtccgtggccttcgtcggcgcgttgtgg
gtggggctgctgctgttcggcgtattcgcggcggtatcggtacagaagagcgtgcgcgat
cgcgtcgacggcatcggcgtgacggcgatccaccatggagaggccgggtgttcggtcgtc
gccgcgctgtcgctgctgaccgtcggtctgtgcaacgcgacgccgcctctgagcgcaaaa
atcgtggaagcggtgttcgccgactacgcgccgatggcaagctggcagtggagcgaggag
acgagcgcgttcctggggcaggcgcggccgcgcagctactgcgtgcagtaccgcgagagc
gacctggatttcgtgcagcggctgctggccgaggaaggcctgggctggaggctgcaggag
gcggccccgtcgcccggcgggcaccagctggtggtgttcgccgacagcgccgcgcaaccg
caggaccccagttcggcgcagggcggcgggctgcgctaccaccgcagcgacgccaccgag
gcggccgacagcgtgctggcgatcggcgccacccggcggctgggcagcggccggctgacg
gtgctcagcgaagacttcaagacgcgccaggcgcgcagcgcgcagttgccgttgcacggc
ggcggcaggcagtcgctgcgctag

DBGET integrated database retrieval system