KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4035Help
Entry
XOO4035           CDS       T00235                                 

Gene name
CelA
Definition
(GenBank) Cellobiohydrolase A (1,4-beta-cellobiosidase A)
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00500  Starch and sucrose metabolism
xoo01100  Metabolic pathways
xoo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO4035 (CelA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XOO4035 (CelA)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     XOO4035 (CelA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 DUF4992 fn3
Motif
Other DBs
NCBI-ProteinID: AAW77289
UniProt: Q5GVI4
Structure
PDB: 

Position
4313615..4315633
Genome map
AA seq 672 aa AA seqDB search
MWASVRCSCAKMGNGIDAVRRTAIHEYGEPLECGRPHHLLRRSPRRRTTDARAHLGRVRL
RTCITHPERASIERNHQSRRITRHFDILISRYYTPFQHLTISRKNSMSSFTNLPPCVTSK
LAVSLLTGALLVPVAASAQSHVDNPFVGASGYVNPDYSKEVDSSIVKVKDVQLKAKMQVV
KSYPTYVWLDSIDAIYGGSRNAGRLSLQGHLNAALAQKKANTPITVGLVIYDMPGRDCHA
LASNGELPLTQAGLQRYKTEYIDVIASTLANPKYKGLRIVNIIEPDSLPNLVTNQSTPAC
GQASSSGIYEAGIKYALDKLHAIPNVYNYMDIGHSGWLGWDSNRSPAISLYTRVVQGTAA
GLASADGFITNTANYTPLHEPNLPNSDLTIGGQPIRSSNYYQWNSFFDESTYAEGLYNGF
VGAGWPSKIGFLIDTGRNGWGGSARPTSASGNDVNTYVNSGRVDRRLHRGNWCNQSGAGI
GMPPTAAPGGHIHAYVWGKGGGESDGSSKYIPNKQGKGFDRYCDPTYTTPDGTLTGALPN
APIAGTWFHAHFVQLVTNAYPAIGTSTKAALQSASTDAVPTSLPTAIKGLTANAADGKVR
LNWSPVSGATGYTVQRFAEAAAAPITVASGLTSSSYVDQALTNGTTYYYKVTANGASGAG
ASSVTVSATPHR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggcgtcagtccgctgcagctgcgctaaaatgggcaacggaatcgacgcagtgcgc
cggaccgcgatccacgaatacggcgagccgcttgagtgcggcaggccgcaccatctcctg
cgccgatcgccccggcgcaggaccaccgatgcacgcgcgcatctggggcgcgttcggttg
cgcacgtgcatcactcaccccgaacgggcatccatcgagagaaaccaccagtcacggcga
atcacgcgacattttgatattttgatatctcgctattacacaccgtttcagcacttaacc
atctcaaggaaaaattcaatgtcatcttttacaaacctcccaccctgcgtcacgtccaag
ctcgccgtttcgttgctgacaggcgcgctgctcgttcccgttgccgcatcggcccagagt
catgtcgacaacccgttcgtcggcgcgagcgggtatgtcaatcccgattattcgaaggaa
gtcgactcgtcgatcgtcaaggtgaaggatgtgcaactgaaagccaagatgcaggtcgtc
aagtcctatccgacctacgtctggctggattcgatcgacgcgatctatggcggctcacgc
aacgccggccgcctaagtttgcaaggccacctgaatgcggcattggcgcagaaaaaggcc
aatacgccgatcaccgtcggccttgtcatttacgacatgccggggcgcgactgccatgcg
ctggcctccaacggcgagctgccactgacgcaagccggcttgcagcgctacaagaccgaa
tacatcgacgtcatcgcatcgacgttggccaatccgaaatacaagggtcttcggatcgtc
aacatcatcgagccggacagccttccgaatcttgtcaccaatcaaagcacgcccgcctgc
ggccaggcgtcatccagcggcatttacgaggccggcatcaagtacgcgctcgacaagctc
catgccattcccaatgtttacaattacatggatatcggccattccggctggctggggtgg
gatagcaaccgtagcccggcaatttcgctatacacacgggtcgtgcagggaacggcagcc
ggtctggccagtgcggatggcttcatcaccaacaccgccaattacacgccgcttcatgaa
ccgaacctgcccaattcggacctgacgatcgggggccagcccattcgctcgtccaactac
tatcaatggaacagtttcttcgacgaatcaacctatgcggaagggctctacaacggcttc
gtcggcgcgggttggcccagcaagatcggctttctgatcgacaccggtcgcaacgggtgg
ggcggcagcgcgcgccctacatctgccagcggcaatgacgtcaacacctacgtgaactcc
ggacgcgtggaccgtcgcctccatcgcggcaactggtgcaatcagagcggtgcggggatc
ggcatgccgccgaccgcggcacccggcgggcatatccatgcctatgtgtggggcaaggga
ggcggcgaatccgacggctccagcaagtacatccccaacaaacagggcaagggcttcgac
agatactgcgacccgacctatacgacgccggacggcacgttgacgggtgccttgccgaac
gcgccgatcgccggtacctggttccacgcgcacttcgtccagttggtcaccaacgcgtat
cccgctatcggcacctcgaccaaggcggcgctgcagtcggcgtcgaccgacgcggtgccc
accagtctgccgacggcgatcaaggggctgaccgccaatgcagccgatggcaaggtcagg
ctcaactggtcgcccgtttccggtgccacgggttacacggtgcaacgtttcgccgaggca
gccgcagctcccatcaccgtcgcatcgggcctgacctcgtcctcatatgtggaccaggcg
ctcaccaacggcaccacgtactactacaaggtaacggccaacggcgcatcgggtgcaggc
gcgagctcggtcaccgtcagcgcgacgccgcatcggtaa

DBGET integrated database retrieval system