KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4398Help
Entry
XOO4398           CDS       T00235                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase beta chain
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XOO4398 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xoo01007]
    XOO4398 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xoo03016]
    XOO4398 (glyS)
Enzymes [BR:xoo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     XOO4398 (glyS)
Amino acid related enzymes [BR:xoo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   XOO4398 (glyS)
Transfer RNA biogenesis [BR:xoo03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    XOO4398 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AAW77652
UniProt: Q5GUH1
Position
complement(4675029..4677266)
Genome map
AA seq 745 aa AA seqDB search
MSEQLPLLIELGTEELPVKALPDLAQAFFDGVLSGLEKRGIAVTRGAAKPLSTPRRLAVL
LPGVATEQPEQRSEVLGPYLNIALDAEGQPTKALAGFAAKAGIDWTALERTSDAKGERFV
HRAVTPGARTAELLPEILREAIAAMPIPKPMRWGGHEYAFARPVQWLVLLFGNEVIPAEL
LGVRGDRITRGHRFMHEGAVSLAVPGDYVEALRAAHVLVDPDARRTRIVEEVEAAAKQAG
GSARISDDNLEQVVNLVEWPSAVLCSFERDFLAVPQEALIETMEINQKFFPVLDDGGTLT
EQFIGIANIQSKDVAEVAKGYERVIRPRFADAKFFFDEDLKQGLQAMGDGLASVTYQAKL
GTVADKVARVAALAEVIAPQVGADPLQARRAAELAKNDLQSRMVNEFPELQGIAGRHYAK
AAGEPSEIALAIDQAYQPRFAGDDIALSPLGKVLAIAERLDTLAGGFAAGLKPTGNKDPF
ALRRNALGLARTVIESGFDLSLTELLKKAVGLVNSALAWSQASKQQTAVEAAKVQGVHVA
ERQSGGLWVPNVEATSAEILDFILDRLRGYYADKGVPATHFNAVAALFSGTSEAVTAPTG
VGAHPGATHGSLYDFDRRIDAIGIFATLPEAQALAAANKRIRNILRKVEGEIPGDIDTAL
LREPAEEALAEAVEAAIGATGDALHRHDYVAVLARLARLRPQVDAFFDGVMVNAEDPQLR
ANRLALLKKLGDRLGSVAAIEHLSS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaacttcccctgctgatcgaactgggcaccgaagagctgccggtcaaggcg
ctgccggatctggcgcaggcgtttttcgatggtgtgctcagcggcctggaaaagcgcggc
attgccgtcacccgtggcgctgccaaaccgctgtccaccccgcgtcgtctggcggtgctg
ctgccgggcgtggccaccgagcagccggagcagcgctccgaagtgctgggaccgtatctc
aacatcgccctcgacgccgaaggccaaccgaccaaggcattggcgggtttcgcggccaag
gccggcatcgactggaccgcgctggagcgcaccagcgacgccaagggcgagcgtttcgtg
caccgcgcggtgaccccgggcgcgcgtaccgccgagctgttgccggagatcctgcgcgag
gccatcgccgcgatgccgattcccaagccgatgcgctggggtgggcacgaatacgccttc
gcacggccggtgcagtggctggtgctgctgttcggcaacgaggtgatcccggccgaattg
ctgggcgtgcgtggcgatcgcatcacgcgcggccaccgcttcatgcatgagggcgcggtc
tcgctggcggtgccgggcgactatgtcgaagccttgcgtgcggcgcatgtactggtggat
cccgatgcgcgccgcacccgcatcgtcgaagaagtggaagcggccgccaagcaggccggc
ggcagcgcgcgcatcagcgacgacaacctggagcaggtggtcaacctggtcgaatggccg
tcggcggtgctgtgcagtttcgaacgcgatttcctggcggtgccgcaggaagcgttgatc
gaaaccatggagatcaaccagaaattcttcccggtgctggacgacggcggcaccttgacc
gagcagttcatcggcatcgccaacatccaatccaaggacgtggccgaagtcgccaagggc
tacgagcgcgtcatccgtccgcgctttgccgacgccaagttcttcttcgacgaagacctc
aagcagggtctgcaggcgatgggcgatggtctggccagcgtcacctatcaggccaagctg
ggcacggtggccgacaaggtcgcacgcgtggcagcgctggcggaagtcatcgcgccgcag
gtgggcgccgacccgctgcaggcacgccgcgctgcagaattggccaagaacgacctgcaa
tcgcgcatggtcaacgaattcccggaattgcagggcattgccggccgccattacgccaag
gccgccggtgagcccagcgagattgcgctggccatcgaccaggcctaccaaccacgcttt
gccggcgacgacatcgcactgtcgccgctgggcaaggtgctggcgattgccgaacgcctg
gataccttggccggtggatttgcggccgggttgaagccgaccggtaacaaggatccgttt
gcgctgcggcgcaatgcgttggggttggcgcggacggtgattgagagtgggtttgatctg
tccctaactgaattgctcaagaaagcagtcggtttggttaattccgctttggcttggtcg
caagctagcaaacaacagacagcggttgaggctgccaaggtgcaaggtgtccatgtcgca
gagcgtcagagcggcggattatgggtgccaaacgtagaggcaacttcagcagaaatcctc
gacttcatcctcgaccgcctacgcggctattacgccgacaagggcgtaccggctacgcat
ttcaacgcggtcgccgcattgttctccggcacgtccgaagccgtgacggcaccgaccggc
gtaggagcgcacccgggcgcgacccacggctccctttacgacttcgaccgccgcatcgat
gccatcggcatcttcgccacgttgcccgaagcccaagcgttggccgcggccaacaagcgc
atccgcaatatcctgcgcaaggtggaaggcgagattcccggcgacatcgacactgcgctg
ttgcgcgaaccggccgaagaagccctggccgaagcggtggaagccgccatcggcgctacc
ggcgatgccttgcatcgccacgactacgttgccgtgctcgcacgcttggcgcgcctgcgc
ccacaagtggatgcgttcttcgacggcgtgatggtcaatgccgaagacccgcagctgcgt
gccaaccgccttgccctgctgaagaagctcggcgaccgcctcggcagcgtcgccgccatc
gagcacttgtccagctga

DBGET integrated database retrieval system