KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00253
Entry
PXO_00253         CDS       T00763                                 

Definition
(GenBank) FHA domain protein
  KO
K11894  type VI secretion system protein ImpI
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_00253
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PXO_00253
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ACD58217
UniProt: A0A0K0GJ66
Position
1606950..1608362
AA seq 470 aa
MSAVSPRLTLTVRDAQAVSGGTQAQASFAAEGGRIGRDATCDWVLEGEGVSRLHASVRHL
DGVYFIEDHSTNGVLHNGVPLRAGFPVPLHAGDALRIDAFEIDVAVSGASVTAGAAATQN
WNHAEPCTLSAMPLPQQSQHAPLEHDVFAALGASSMRATDTDPLALFATSFTLAGRQSDA
AAFGLGHAPATAEAYRAPVAAPAAGGVVLPEHWDLTRSEFALPPAADPVADMQAPLPSAA
VPIAPAAAAPAPTPTPTPTPLPLPLPLPTPVSQTRGAAVAVSAAAPSAAQPVVAHTPDTP
ELPALFAAMTAGLMDVLRARAAFKNSLRVPVTLIQRTENNPLKFAATVDEAVARLLAPPS
PGYLTGAAAIEEAVEDIGRHQLALLAGMRAAFEHVFAQFDPARFEADTAGSALGSWGNRP
WRRYAQHYRELLGDPDERFRRLFGEEFARAYEQQLARAKAQAQPTDGDRA
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgagcgcggtgtcaccccggctgacgctgacggttcgcgatgcgcaggcggtgtcgggc
ggcacacaagcgcaggccagcttcgcggcagaaggcgggcgcatcggccgcgacgccacc
tgcgattgggtgctcgaaggcgagggggtgtcgcgcctgcacgccagcgtgcgccatctc
gatggggtgtatttcatcgaagaccacagcactaacggcgtgttgcataacggcgtgccg
ctacgtgccggttttccggtgccgctgcatgccggcgacgccttgcgcatcgatgccttc
gagatcgacgtggcggtgtcgggcgcaagcgttaccgctggtgcagccgcgacgcagaac
tggaatcacgccgaaccgtgcacgctgtcggcaatgccactgccgcagcagtcgcagcac
gcgccgctggagcatgatgttttcgccgcgcttggggcgtcgtcgatgcgggcaaccgac
accgacccactggcattgttcgccacctcgttcacgctggccggccgccagagcgatgcg
gcggcgttcgggctggggcatgcgccggcaacggccgaggcctaccgtgcacccgtggcc
gcgccggctgccggcggcgttgtgttgcccgagcactgggacctgacacgcagcgaattt
gcgctgccgccggctgccgatccagtggcagacatgcaagcgccactgccgtccgccgca
gtgcctattgccccagcggcggcagcacccgcaccgacgcccacacccacacccacacca
ctgccactgccactgccactgccaacgccggtctcgcaaacgcgtggcgcggcagtagcg
gtgagcgctgccgccccctccgcggcgcagccggtagttgcacacacgccggataccccc
gagctgcccgcgctgttcgccgccatgaccgctggcttgatggatgtcttgcgcgcgcgt
gcggcgttcaagaacagcctccgcgtgccggtcacgctgatccaacgcaccgagaacaat
ccgctcaagttcgccgcgacggtggacgaggcggtcgcccgcctgttggcgccgccgagc
cctgggtatctgaccggtgcggccgcgatcgaagaagcggtggaggacatcgggcgtcac
cagctggccttgttggccggcatgcgtgccgccttcgagcatgtgtttgcccagttcgat
ccagcgcgcttcgaggcagacaccgccggctccgcgctcggttcctggggcaatcggccc
tggcgacgctacgcgcagcattaccgcgagttgctcggcgatcccgacgagcgcttccgc
cgcctgttcggcgaagaattcgcccgcgcctacgaacaacagctggcccgtgccaaggcg
caggctcaacccacagacggcgaccgagcatga

DBGET integrated database retrieval system