KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00262
Entry
PXO_00262         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_00262
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_00262
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACD58209
UniProt: A0A0K0GJ13
Position
1596015..1596518
AA seq 167 aa
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHE
DALQAYPHVASSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKV
DIGRMDRMSLSFVIDSELWAQPLPLALYLRTDLDLETGRFSLSSAGH
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccgaactgacccaacaagagcgtttgcagccatcgctgctggaccgattgatcgac
gaccgccgacacgaaccggcggaaagccgcgacgcgcgggcgatcagtccagccaagctg
cgcgactgcgtcatgcgcgacctggcctggctgctcaattgcacgcgccactggcatgag
gatgcgttgcaggcgtatccgcacgtcgccagctcggtactcaattacggcattcccgac
ctggccggcgcacggctggcggggctggacgtgatcgcactgcagaaccgcattcgtgag
gcgattgtggcgttcgagccgcgcctggctgcggccagcctgcaggtcaccgcgaaagtg
gatatcgggcgcatggaccgcatgtcgctgtccttcgtcatcgattccgaattgtgggca
cagccgctgccgctggcgctgtatctgcgcaccgatctcgatctggaaaccggtcgtttc
agtctgtcttcggcaggccactga

DBGET integrated database retrieval system