KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00658Help
Entry
PXO_00658         CDS       T00763                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00480  Glutathione metabolism
xop00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PXO_00658
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PXO_00658
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PXO_00658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACD58834
UniProt: A0A0K0GKJ3
Position
2267628..2268113
Genome map
AA seq 161 aa AA seqDB search
MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctctccacctttgaattcaccgaccttgagggtcgcacgcagacgatgcgc
gactacgccggcaaggtgctgctggtggtgaatgtggcatccaaatgcggctttacgccg
cagtacgccggcttgcaggccttatggcaacgctatcgcgagcgcgggctggtagtcatc
ggatttccgtgcgatcagtttgggcatcaagagccaggtgatgcggcgcagatccgccaa
ttttgctcgctcgactacgcagtggattttccgctggccgaaaaaatcgaggtcaacggc
agcggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcggctcc
gaggcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccacgaccaagccggaagcattggccgcagatatcgagcgtgcattggac
gcatga

DBGET integrated database retrieval system