KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01285Help
Entry
PXO_01285         CDS       T00763                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop00051  Fructose and mannose metabolism
xop00562  Inositol phosphate metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
xop01230  Biosynthesis of amino acids
Module
xop_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_01285 (tpiA)
   00051 Fructose and mannose metabolism
    PXO_01285 (tpiA)
   00562 Inositol phosphate metabolism
    PXO_01285 (tpiA)
Enzymes [BR:xop01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PXO_01285 (tpiA)
Exosome [BR:xop04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PXO_01285 (tpiA)
  Exosomal proteins of bladder cancer cells
   PXO_01285 (tpiA)
  Exosomal proteins of melanoma cells
   PXO_01285 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACD60095
UniProt: B2SVM1
Position
complement(3615110..3615865)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRAFATELVAKLAAHMPLEGIDVVILPPLPYLGDLIEDFEAHHLSF
GAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESSELVARKFAAAIHAGL
TPVLCVGESLEQREAGQTEAILRAQLEPVLALVGSAGFAGAVLAYEPIWAIGTGCTATPE
QAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgccacc
gaactggtggccaagctcgccgcgcacatgcccctggagggtatcgacgtcgtcatcctg
ccgccactgccttacctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttc
ggagcccaggacgtcagcagcaatgagaagggcgcctacactggcgaggtctcggcctcg
atgttggtggatgtcggtgccggctacgggctggtcggccactccgagcgccgtcagtac
catcaggagagtagcgagctggtggcgcgcaagttcgccgccgcgatccatgccgggctg
actccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagactgaggca
atcctacgtgcccagctcgaaccggtcctggcgctggtcggcagtgccggtttcgcgggc
gccgtgctggcctatgaaccgatctgggccattggcaccggctgtaccgccacgccggag
caggcccaggccgtgcacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatc
gctgattcgttgcccatcctgtacgggggcagtgtcaagcccgataacgccggcgagctg
tttgcacagcccgatgtcgatggcgggctggtcggaggcgcttcactggtcgccgaagat
ttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system