KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01645Help
Entry
PXO_01645         CDS       T00763                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop00052  Galactose metabolism
xop00500  Starch and sucrose metabolism
xop00520  Amino sugar and nucleotide sugar metabolism
xop00521  Streptomycin biosynthesis
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_01645 (glk)
   00052 Galactose metabolism
    PXO_01645 (glk)
   00500 Starch and sucrose metabolism
    PXO_01645 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PXO_01645 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PXO_01645 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PXO_01645 (glk)
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PXO_01645 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACD59749
UniProt: A0A0K0GLD3
Position
complement(3244170..3245168)
Genome map
AA seq 332 aa AA seqDB search
MEAVAFPRPETFVAADVGGTHVRLALVCESNDAGKPVTVLDYRKYRCAEYPGLAEIMAAF
FAEVGCAPVCRGVIASAGYALDDGSVITANLPWVLAPEQIRRQLGMQALYLVNDFEAVAY
AANYMSGNQVMQLSGPAQGAAGPALVLGPGTGLGAALWIPHGAHPVVLPTEAGHAALAPA
SDLEVELLQELRRTRTHVCTETLLSGPGLLNLYTALGALRGDAVLHANPAEITAAALAGN
DALAHDALQAFCGFMGSVVGDLMLLYGVRSGVYLAGGFLPQIAGFIAESDFVARLLDKGA
LRPALEQVPVSIVEHGQLGVIGAASWFLLHGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggtggcctttccgcgccccgaaaccttcgttgccgccgatgtgggcgggacg
cacgtgcgcctggcgctggtgtgcgaaagcaatgacgcaggcaagccagtcactgtgctg
gactatcgcaagtaccgttgcgccgagtatccgggtcttgccgagatcatggccgccttc
ttcgcggaggtgggctgcgcgccggtgtgccgtggcgtgatcgccagcgccggttacgca
ttggacgacggcagcgtgatcaccgccaatctgccctgggtgctggcccccgaacagatt
cgccgccagctgggcatgcaggccttgtatctggtcaacgatttcgaagcggtcgcctac
gcggccaattacatgagcggcaaccaggtcatgcagttgtcgggccccgcgcaaggcgcc
gcgggcccggcgttggtgctcggtccggggacgggcctgggtgcggcgctgtggattccc
cacggtgcccacccggtagtgctgccgaccgaggctggccacgcggccctggcacctgcc
agcgatctggaagtggaactgctgcaggaactgcggcgcacgcgtacccacgtgtgcacc
gagacgctgttgtccggcccgggcctgttgaatctgtacaccgcgctgggcgcactgcgc
ggcgacgctgtgctgcatgccaaccccgccgagatcaccgctgccgcattggctggcaac
gatgcactggcgcacgatgccttgcaggcgttctgcgggttcatgggcagcgtggtcggc
gacctgatgctgctgtatggcgtgcgtagcggtgtctatctggctggcggcttcctgccg
cagatcgccggctttatcgctgaaagcgatttcgtcgcacgcctgctcgacaagggcgcg
ttgcgtccggcgctggaacaggtgccggtgagcatcgtcgagcacggccagctcggcgtc
atcggtgcggccagctggtttctgctgcacggccgctga

DBGET integrated database retrieval system